Conserved Protein Domain Family
DUF452

?
pfam04301: DUF452 
Protein of unknown function (DUF452)
Statistics
?
PSSM-Id: 113085
View PSSM: pfam04301
Aligned: 2 rows
Threshold Bit Score: 457.524
Threshold Setting Gi: 81784975
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81636413   1 MKTQHISQQGDNLIVYFAGWGTPPSVVEHLILPENYDLCLCYDYRDLHCDVDFSAYQHIRVVAWSMGVWVAERVMQGYPL 80
gi 81784975   1 METKFYNHQGGHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLDFDFSAYRHIRLVAWSMGVWAAERALQGIRL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81636413  81 LSATAINGTGLPCDDQYGIPEAIFAGTLSGLNEDNRTKFERRICGSKTLLRDYQHYSMRPtLQEIHAELTALYTFLQQDR 160
gi 81784975  81 KSATAVNGTGLPCDDNFGIPCTVFKGTLENLTENTRLKFERRMCGDKASFEDYQQFPARP-FGEIHQELIALFAMIGQDR 159
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|...
gi 81636413 161 RTDLISWSKAIVGSKDKIFPAQNQRAYWQDRCAITEIAGEHLLFPHFTHWETC 213
gi 81784975 160 RTDLIRWTNALVGSGDKIFMPANQHRYWTPRCTVREIDVGHYLFSRFTHWSAL 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap