Conserved Protein Domain Family
Reo_sigmaC

?
pfam04582: Reo_sigmaC 
Reovirus sigma C capsid protein
Statistics
?
PSSM-Id: 113356
View PSSM: pfam04582
Aligned: 4 rows
Threshold Bit Score: 512.926
Threshold Setting Gi: 75568157
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81968112   1 MAGLNPLQRREVVSLILSLTSSTTTNPGDLTAVYERLTNLEASTKSLRQSLSSIVSDLSDVSVDLQDTTRALDDAIATLK 80
gi 75568157   1 MDGLTQQQRREVVGLILSLTSSVTINPGDLTQIRERLSALESANASLSESVNTALSRLTDLSAALGNMATSVAEMKVELN 80
gi 81968111   1 MAGLTPSQRREVVGLILSLTSSANTNCGDLTPVYDRLLSLESAVASLDGSVGVLSQKVSDLESDLQGVVSSLGQANSTLT 80
gi 7288540    1 MAGLNPSQRREVVSLILSLTSNVTISHGDLTPIYERLTNLEASTELLHRSISDISTTVSNISANLQDMTHTLDDVTANLD 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81968112  81 GLNTTVAALQNSVASLSSTVNGLTDISSAHSEALSFLRTTIDGNTVAISNLKGDVSTNGLNIADLQNRMKSLESSTSHGL 160
gi 75568157  81 SLISDVQALRTSLDSSSSELASLSLLVHDHDSSISDLQKESHALSGDITNLNSSVSAQGLTISSLEQRVQALEGGSSTSL 160
gi 81968111  81 ELSKELRQLSSSVDNLMTSLSDLSTTVSGNQAAIAGIQTSVHANTTDISNLKSSVSAISLNITDLERRVGDIESGSGPNL 160
gi 7288540   81 GLRTTVTALQDSVSILSTNVTDLTNTSSAHAATLSSLQTTVDGNSTAISNLKSDVSSNGLAITDLQDRVKSLESTASHGL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81968112 161 SFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAKLMQFQWMAKGTSGSSDVIDMTVNAHCHGRRTDYMMSSTGGLTVT 240
gi 75568157 161 LFADPLKLEAGTVSLELDPYFCSVSRNLTSYSADAQLMQFQWSVKGEDGATNSIDMDVNAHCHGPRTDYLMSTKQSLTIT 240
gi 81968111 161 RFVSPLSLSQGVVSLVMDPYFCSDNQALTSYSTDAQLMQFQWLARGEDGSSSSVDMLVNRHCHGRRTDYMMSTTESFTVT 240
gi 7288540  161 SFSPPLSVADGVVSLDMDPYFCSQRVSLTSYSAEAQLMQFRWMARGTNGSSDTIDMTVNAHCHGRRTDYMMSSTGNLTVT 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81968112 241 SNAVSLTFSLDYITNMPSDLSRLIPSVGFQAASFPVDVSFTRDSATHSYQVYGAYSSARVFTITFPTGGNGTSNIRFLTV 320
gi 75568157 241 ASPATLVFELDRITKLPPDLSRLIPCHGFQQATFPVDISFQRDGVSHSYQVYGTYTSSRVFKITFSPGASGPAVIQFLTV 320
gi 81968111 241 GNSVSLVFNLDYITKPPSDMSRLVPRAGFQAASFPVDVSFTRDTTTHAYQVYGAFSSPRVFKITFLTGGTGTANLRFLTV 320
gi 7288540  241 SNVVLLTFDLSDITHIPSDLARLVPSAGFQAASFPVDVSFTRDSATHAYQAYGVYSSSRVFTITFPTGGDGTANIRSLTV 320

                ....*.
gi 81968112 321 RTGIDT 326
gi 75568157 321 RTGIDT 326
gi 81968111 321 RTGIDT 326
gi 7288540  321 RTGIDT 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap