Conserved Protein Domain Family
Bys1

?
pfam04681: Bys1 
Blastomyces yeast-phase-specific protein
The molecular function of this protein is not known. Its expression is specific to the high temperature, unicellular yeast morphology (as opposed to the lower temperature, multicellular mycelium form).
Statistics
?
PSSM-Id: 113449
View PSSM: pfam04681
Aligned: 2 rows
Threshold Bit Score: 301.169
Threshold Setting Gi: 74625038
Created: 18-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74625036  21 ESVVAKRADLGNAFVFIYCNFTVFLDVEAGGVSTRRTLNGRNHDYYHEPYGGGSGDGVSLTLSHTEGRDSSNSRTTFRYK 100
gi 74625038  21 ESVIAKRADLGSAFVLVYCNFSVALDIQAGETSTRKILDGRSYDYHNEKYRPGSGDGVSLTLHHTDGPDSSNSETTFRYK 100
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 74625036 101 LSDGNSTVGYSLGNSGGNPFEGHKLTLKPSDDRCPRIEWPDGIPTGVSSGSCGSGANLILTMCPLERPRQEFEDE 175
gi 74625038 101 LADDNSTVEYSLGNSGGNPFAGHKITLKSSGDGCPSIEWPEGIPTGVSSGSCGSSENLILTLCPPGTSLDDFEDE 175
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap