Conserved Protein Domain Family
Umbravirus_LDM

?
pfam04817: Umbravirus_LDM 
Umbravirus long distance movement (LDM) family
The long distance movement protein of Umbraviruses mediates the movement of viral RNA through the phloem of infected plants.
Statistics
?
PSSM-Id: 113583
View PSSM: pfam04817
Aligned: 4 rows
Threshold Bit Score: 332.248
Threshold Setting Gi: 81971872
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81969059   1 MASVVNVNLNSKSGLQTRTTGRPLRGGNYERTPGKQSRSSHPRQRKCAGNTHPAATPRHSKPAVQGTKEVPPHSPHRRNV 80
gi 81971867  27 MSSVINVFASGKSCDSRGAPRSSVRGGHRTGAPRNKPGGTHTPSRRPKGGVHPATTSKDPNKNIRSPPAPTPHKEHRGPA 106
gi 81971872  27 MSSIINVFASGKSRDTRGTPRSSVWRGHRTGAPRDKPWGAYTPSRRPKGGVHPATASKDPNENIRGPSASTTHQEHWGSV 106
gi 75568384   7 MTIIINV-NNDERKQPEGATGSSVRRGDNKRTRGNKPRSHHPGSRERKGYNHPSPTPKNSKQGQLRTEAVQEHPKHGGTA 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81969059  81 VHREGGYCFDAPRAGRLSRRGGGLHSRQPTPQSQLNGREGESRAQWRAEVDGLLSPLLDTIVGHGWNPTKVFLRGIQLGR 160
gi 81971867 107 IPGENRGGVHTTRARRRARRSGGMDPRQLTAQPQQRWAETKIPTERRAAIDGLLPPLLNTLDGQIQGNAALLRYCVGAVK 186
gi 81971872 107 VPGKSCGGVHTPRTGRRTRRSGSMDTRQSTAQPKQRGATAAIPPERRAKIDGLLPPLLDTFDGQIQGDAALLRYCVGALK 186
gi 75568384  86 FRRESGGSVHPSHPRRRARRGGDMAPRQHPPPPRERRTKTETQAERRAQALSVLPTLLDCIGGLDLGPAEVLLHCHRAVR 165
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 81969059 161 VYTRNKRgEPILNVSDVAPKRGEQVSQLPATKPQITPSLPTQGPANATPIGPPAEVPQRRDVEQVCTTCDGN 232
gi 81971867 187 RELRRRW-KPVQPAHHVAASSGKPSPQLSDEAARNAEDLSRDGEGRAGKSVQQEVLHSGSSVPEVCADCGKL 257
gi 81971872 187 RELRRRR-KPVQLAHNVAASGGEPSSQLPDEAAKDAENLPGDGEGRAGKSVQQEVLHSGGSVPAVCADCGKP 257
gi 75568384 166 RQLRTGV-QPIQPVPHVESTHRSSDPQLLESSTTCSANLQNDGAGRVIGGGIPTAIPEGSDVEQVCHASHYG 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap