Conserved Protein Domain Family
MbeB_N

?
pfam04837: MbeB_N 
MbeB-like, N-term conserved region
This family represents an N-terminal conserved region of MbeB/MobB proteins. These proteins are essential for specific plasmid transfer.
Statistics
?
PSSM-Id: 113603
View PSSM: pfam04837
Aligned: 9 rows
Threshold Bit Score: 57.8331
Threshold Setting Gi: 117269
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|..
gi 75342410    1 MSNLLQMGTDFEKKLKERAVSTENMLNSEFRKLEASVDRELKLNGQKIRDAI 52
gi 75342062    1 MNSLLTLAKDLEQKSKAQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAI 52
gi 75348519    1 MSSLLTLAKDLELKSKEQQQSTERMLKTVFSEHERSVRQELNESAKRISDAI 52
gi 75415211    1 MSEMSRLATAFEERSKEQAESTEKAVRSAFEKHESALLSALSESEKRTSDAI 52
gi 75420554    1 MSEILNLAREFESKSKQQAKTTATSVASAFEKHEKRITEALKLSSGNIQTAI 52
gi 117269      1 MSKISDLAKTFEQTSRTEAASIEQQTKADLETLRKNINEALKQSEQKITADI 52
gi 75488196    1 MSRILNLAQTFSESARQDSEIMTEKVKLAIEQHENDLKAQLADASRNLSESI 52
gi 499192668   1 MSKILDLAQTFQQTSQKELESTSEIVQNAIKRHEQNLIQQLQHAGNNLAENI 52
gi 388350788   1 MSNLLQTGAEFEKKLKERAESTEKMLNNEFRRLGESVSEAVTSNETKIRDAI 52
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap