Conserved Protein Domain Family
UAF_Rrn10

?
pfam05234: UAF_Rrn10 
UAF complex subunit Rrn10
The protein Rrn10 has been identified as a component of the Upstream Activating Factor (UAF), an RNA polymerase I (pol I) specific transcription stimulatory factor
Statistics
?
PSSM-Id: 113985
View PSSM: pfam05234
Aligned: 2 rows
Threshold Bit Score: 149.58
Threshold Setting Gi: 1723521
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 586409    1 MDrN--VYEACSNIIKEFGTHVVSADEVLAekiDNAVPIPfktrEEIdadveKDrnegvfegniiPDIdLRVVHYYATQL 78
gi 1723521   1 MS-NppTRPTLYNLVNADGELSYRARDLVQ---DFSVPIP----HEL-----PD-----------PDL-VHSIQDFATEY 55
                       90       100       110       120
               ....*....|....*....|....*....|....*....|..
gi 586409   79 CLNKYPHLINAFDETSLITLGLLIEKWVKDYLTSIQTEQGRQ 120
gi 1723521  56 MLATGKKSFECLDESALLGLGYLVTEWMDAMVTDCLEEFEER 97
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap