Conserved Protein Domain Family
Borrelia_P83

?
pfam05262: Borrelia_P83 
Borrelia P83/100 protein
This family consists of several Borrelia P83/P100 antigen proteins.
Statistics
?
PSSM-Id: 114011
View PSSM: pfam05262
Aligned: 3 rows
Threshold Bit Score: 594.288
Threshold Setting Gi: 122292643
Created: 17-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122292643  28 EKLKDFV-NMDLEFVNYKGPYDSTNTYEQIVGIGEFLARPLINSNSNSSyyGKYFVNRFIDDQDKKA-SVDIFSIGSKSE 105
gi 81344810   23 RRELERA-NATVEFENFAGTHTDVDSAAAIRRIGEGLASALRGGVAGDR--ARYALIHAVGPHTTNGfDADILIIGAQAR 99
gi 488757488  25 KPEIDSVkNKTIEFINYTGPHDVVDSADTIRGIGSNLAGAVKAGRAGDM--NRYSVIHCVDPAVKEGlDADIFIIGKNAG 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122292643 106 LDSILNLRRILTGYLMKSFDYERSSAELIAKAITIYNAVYRGDLDYYKEFYIEASLKSLTKENAGLSRVYSQWAGKTQIF 185
gi 81344810  100 VDHIDNIREIVAAYLSAAYGYRLQDARTIATFTTVYNAVYRADLPTFKARYKGVVTAHLSPEHVGIARRFDQWPGKTQLV 179
gi 488757488 103 VDHINNVRLIIAGYLKAAYGYSDKDAATLAHFVTIYNAVYRKNMDFFNQKYKQVVTKNLTKEKAGLALRYDEWPGQTQIV 182
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122292643 186 IPLKknILSGNVeSDIDIDSLVTDKVVAALLSENESGVNFARDITDIqgethkadqdkidieldnihesdsnitetienl 265
gi 81344810  180 IPLS--GHSDAL-SAVDTGAISDKRVVERLREDPDKNVDLRRDMIDL--------------------------------- 223
gi 488757488 183 IPLTdqKYAGTI-SSVDTTSISDKKVVEKMREDKGKDLEKRKEMVDL--------------------------------- 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122292643 266 rdqlekatdeehkKEIESQVDAKKKQ--KEELDKKAIDLDKAQQKLDFAEDNLDIQRDTVREKLQEninetnkEKNLPKP 343
gi 81344810  224 -------------KEREAQEGTRRAQqlAQQSQQAQERAAELSTQAQRAQAHADKTRREAQQAQQA-------AQNSPDP 283
gi 488757488 229 -------------KERESEEAAKRAEvaKKEADVKQKEADKQKKEADTKQKAAEKQKKETEQKQKE-------AKKAEEK 288
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122292643 344 GDVSSPKVDKQLqikesledlqeQlkeasdenqkreiEK-QIEIKKNDEELLKNKDHk------AFDLKQElnSKASSKe 416
gi 81344810  284 ARTQEAKEKERV-----------A-------------ERaQQEAQQAAHTAQKATEQ-------AESLARE--ARSQEQr 330
gi 488757488 289 AATTGKPEDKKV-----------Aeekk------keaEKsQKETEKKTEEAKKAKDAadekqkkADEAKKE--VKEEEKm 349
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122292643 417 kiegeeEDKELDSKKKLEPVSEadkvdkisksnnnevsklspldkpsysdidskegvdnkdvDLQKTKPQVESQPTSLNE 496
gi 81344810  331 -----aQQKSAEAQRERLEVAG----------------------------------------DMQRMMNAGRAKATHGAQ 365
gi 488757488 350 -----aEKKTEEAQTDRKDIAS----------------------------------------DTQKIIEEKKAEKKAEGD 384
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122292643 497 DlidvSIDSSNPVF-LEVIDPITNLGTLQLIDLNTGVRLKESAQQGIQRYGIYEREKDLVVIKID-SGKAKLQILD-KLE 573
gi 81344810  366 E----ARESVTPCYgLKVVDAQHLLSEIVLVDPKTEAPLRSSSLRTVRNRLLYSEPHALVAIADT-TGNGTVRLVHiDPK 440
gi 488757488 385 A----AIASSIPGYgLKVVDDSKMLSELVLLDLKTEEELRTSGINTIRGRNLHIVGKNLMAIAGTkSGNAVIALVLiDAK 460
                        570       580       590       600       610       620
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 122292643 574 NLKVISESNFEINKNSSLYVdsrmiLVAVk--DDSNAWrlakfspknldefilsenKILPFTSF 635
gi 81344810  441 TLEVTKESTQRIAAQSFLLR-----ERGAllcGDRRKW------------------QPLPGTLY 481
gi 488757488 461 SLEIVKQSQENIAGESVLIKngndyYAVI---DNNGKYfigryndkl-elqaksavEVLPYTPI 520
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap