Conserved Protein Domain Family
DUF730

?
pfam05325: DUF730 
Protein of unknown function (DUF730)
This family consists of several uncharacterized Arabidopsis thaliana proteins of unknown function.
Statistics
?
PSSM-Id: 114071
View PSSM: pfam05325
Aligned: 3 rows
Threshold Bit Score: 185.737
Threshold Setting Gi: 75157209
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75099343  20 MEIRMRTRYDKNRRRDKGVPIECDCNAKVVVATSLDPVTTGKLFFSCPHEISDGPGQGCGFKRWWTVALCDEFDMIKEET 99
gi 75157209  29 MEIRMRMRYGENRRRDKGVLIELDCNAKVVVATSHDPVTSEKLYFSCPYKISDGSGRGSGFKRWWTVALCDEFDMIKEEM 108
gi 75215481  29 METRMRMVYGENRRRDKGVPIECGCSAAVVVATSRDPITSGKLYFSCPYEISDGPGRDCGFKRWCAVPLCDEFDKIKEEK 108
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 75099343 100 TEMKKDLEAANkrvesqtekiflmekkfetlekkyesLNKYL 141
gi 75157209 109 IEMKKDLEAAN--------------------------ICELS 124
gi 75215481 109 NEMKQDLVAAKkhvegqaekiflmekkfetlekkyesMNKYS 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap