Conserved Protein Domain Family
Citrus_P18

?
pfam05520: Citrus_P18 
Citrus tristeza virus P18 protein
Statistics
?
PSSM-Id: 114252
View PSSM: pfam05520
Aligned: 3 rows
Threshold Bit Score: 290.451
Threshold Setting Gi: 81924821
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81968537   1 MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSEDMLNSFSAISNCTIIADGSALLKDNTVVDRLESMN 80
gi 81924821   1 MSGSLGNSTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPSEHMLNSFSAISNCTIIADGSALLKDNTVVDHLESMN 80
gi 81936114   1 MSGSLGNSTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNEDMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMN 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81968537  81 PLAYLLKLAKTTTTICFTMSNKVLFGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYNNGTFQNGLTRCNNL 160
gi 81924821  81 PLAYLLKLAKTTTTICFTMSNKVLFGTTKSEPLSCLAISADRVLFKVIIGTNVDDSRCGCSIWFYDNGMFQNGLTRCNNL 160
gi 81936114  81 PLAYLLKLAKTTTTICFTMSNKVLFGTTKSEPLSCLAITSDRVLFKVVMGTNVDDSRCGCSIWFYNNGTFQNGLIRCNNL 160

                ....*..
gi 81968537 161 VALFSAT 167
gi 81924821 161 VALFSAT 167
gi 81936114 161 VTLFSVT 167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap