Conserved Protein Domain Family
Peptidase_C42

?
pfam05533: Peptidase_C42 
Beet yellows virus-type papain-like endopeptidase C42
Members of the Closteroviridae and Potyviridae families of plant positive-strand RNA viruses encode one or two papain-like leader proteinases, belonging to Merops peptidase family C42.
Statistics
?
PSSM-Id: 114264
View PSSM: pfam05533
Aligned: 8 rows
Threshold Bit Score: 111.331
Threshold Setting Gi: 81993673
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81983932  882 EDLKDGYCYIRHIAEVCLSMGKVFFRRDV----NLGAFPYVFEVQHRLERLYGKRAVEYGVRGYFSATRLYHCCFTDSPR 957
gi 81923170  297 IRYPNGFCYLAHCRYACAFLLRGFDPKRF----DIGAFPTAAKLRNRMVSELGERSLGLNLYGAYTSRGVFHCDYDAKFI 372
gi 81948740  754 DKYKNGYCYLAHCRYASAFLLKGFHPAVF----DIGANPTAAKLRSRMVSVLGDRSLSLNLYGSFTSRGIFHCDYDAAYV 829
gi 81948740  485 ECYPDGLCYMAHMRYLCAFFCQPFRESDY----PLGSWPSVARLKALVLKRFGDEALNIGVRGYYVSRRAFHCDYDSKYA 560
gi 81923170   23 VIYPDGRCYLAHMRYLCAFYCRPFRESDY----ALGMWPTVARLRACVEKNFGVEACGIALRGYYTSRNVYHCDYDSAYV 98
gi 81984625  502 YRPGEGLCYLAHAALCCALQKRTFREEDF----FVGMYPTKFVFAKRLTEKLGPSALKHPVRGRQVSRSLFHCDVASAFS 577
gi 81993673  397 AKVRDGQCYVRHVFDVALYFGR---RADLsvrrALGMYPTVGALKAYLVREYGRDSLKVPMRGTYTFGSVFHCLSTKSSV 473
gi 81993673  888 ESLKDGYCYIRHFAEVSLSMGRIFFRRDV----DLGPFPYVFEVQHRLERLYGKAALRYGVRGQYSAPRCFHCCYNDSPR 963
                         90
                 ....*....|....
gi 81983932  958 -PFKSLNMYhkMGG 970
gi 81923170  373 kDLRLMSAV--IAG 384
gi 81948740  830 kDLRFMSAI--VAG 841
gi 81948740  561 rSLMRLAGY--VGG 572
gi 81923170   99 kYFRNLSGR--IGG 110
gi 81984625  578 sPFYSLPRF--IGG 589
gi 81993673  474 -DLRSIPNHhlVGG 486
gi 81993673  964 -PMASFNGYhkMGG 976
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap