Conserved Protein Domain Family
DUF782

?
pfam05614: DUF782 
Circovirus protein of unknown function (DUF782)
This family consists of porcine and bovine circovirus proteins of unknown function.
Statistics
?
PSSM-Id: 114342
View PSSM: pfam05614
Aligned: 2 rows
Threshold Bit Score: 195.333
Threshold Setting Gi: 81982029
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 78099030   1 MVTIPPLVSRWFPVCGFRVCKISSPFAFTTPRWPHNDVYIGLPITLLHFPAHFQKFSQPAEISDKRYRVLLCNGHQTPAL 80
gi 81982029   1 MVTIPPLVSRWFPVCGFRVCKISSPFAFATPRWPHNDVYIRLPITLLHFPAHFQKFSQPAEISDKRYRVLLCNGHQTPAL 80
                        90       100
                ....*....|....*....|....
gi 78099030  81 QQGTHSSRQVTPLSLRSRSSTFNK 104
gi 81982029  81 KQGTHSGRQVTPLSLRSRSSTFHQ 104
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap