Conserved Protein Domain Family
DUF819

?
pfam05684: DUF819 
Protein of unknown function (DUF819)
This family contains proteins of unknown function from archaeal, bacterial and plant species.
Statistics
?
PSSM-Id: 114410
View PSSM: pfam05684
Aligned: 6 rows
Threshold Bit Score: 347.07
Threshold Setting Gi: 75180453
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81793385  17 GLIAATLGAVFWTsarERGPWQRFYAVVPALLLCYLLPGIYNTVGLI-DGANTWLYNPIARDVLLPAALILLTLSIDLRA 95
gi 81786064  10 SILIGMTALIVWA---EYKIGGKFFKYVPAIVLIYLGAAFMNTFGLFgDSESLSNTSYGVRNALLPAMILLMLLQCDLRK 86
gi 81485519  11 AFLMCLAGCLLLL---EKYSKWKIFNVVPALVFIYILNMFFCTMGLF-DSEACSKAYSVLKNNLLYAMIFVMLLRCDFRK 86
gi 81341903  15 GFIAVWAAVSIGL---EQRFKWA--SAVSGAIIALAGAMVFTNVGVL---PVESPVYDTVWSYVVPLAIPLLLFQINVRQ 86
gi 75171548  79 AALFAAGAFGVWS----EKTKIG--SMVSGALTSTLLGLAASNLRLI---PFETPSYGFFMEFLLPHTIPLLLFRADLRR 149
gi 75180453  95 TALFATGALGLWS----EKTKVG--AAMSGALVSTLVGLAASNLGII---SSQAPAFAVVLNFLLPLAVPLLLFRADLRR 165
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81793385  96 ILRLGPKLVAMYLGASLSIMLGAVVAFWVMRWLhpatVAGDTWAGMAALAGSWIGGGANMLAMREVFAVNASTFGQFAVV 175
gi 81786064  87 IIKLGPKLLITYFVAAFSIVLGFTLTYLVMQSF----FLDDTWRAFSALAGSWTGGSANMVALQDILAVPETIFGYALIM 162
gi 81485519  87 LAKLGGRMVAIFLACSFTLFIGFIVGYPIFKSF----LGTDVWGAVAALYASWVGGSANMAAMQAALPVDAGAYSCALAL 162
gi 81341903  87 IFKESRRLLFIFLISSVGTVLGSILAFFLLKQH-----IPYLDKIGGMISASYIGGGVNFAAMAAKFETPGEYVSATVVA 161
gi 75171548 150 IIRSTGSLLLAFLIGSVATIVGTVVAFMLVPMRs---LGPDNWKIAAALMGSYIGGSLNFVAISEALQISPSVIAAGVAV 226
gi 75180453 166 VVQSTGKLLLAFLIGSVATTVGTALAYYLVPMKs---LGPDSWKIAAALMGRHIGGAVNYVAISNALGVTPSVLAAGLAA 242
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81793385 176 DVGVGYVWMAVLIFLAGRARSIDARSGADTRALDALQERMARFQAEHARIPSL-SDLMVIVAVAFGGVGLAHALANPLAg 254
gi 81786064 163 DTINYSFWVMVMFWLVPFERMFNRWTKADTSKLESMSQEIAATVTDEKREPTTfVHMIGLLGFSLFIAALATVIGENLP- 241
gi 81485519 163 DTVCYSVWIALLLLMVRYSSKWDNATKADTSKLQAVADAAAKEVEKEKKTASA-ADWIFLIGISLMVSAVSQMVGAHLQ- 240
gi 81341903 162 DNFMMALLFFILISIPALKWFQRHYAMPFEEKVKADGNSGNSAESYWKRKDISlKDIAFNAGAAFALVAVSMKVSGYFKs 241
gi 75171548 227 DNVICALHFMVLFALAS-------KIPPETASASSPDADMTKDDKLEDKNRV--VSTSIALSVSFLICKAAITLTTLF-- 295
gi 75180453 243 DNVICAVYFTTLFALGS-------KIPAEAVPPPTTIVDAETNEASETKNKIPvLLIATGIAVSLAICKAGALLTKYF-- 313
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81793385 255 wckvNLSWARqfsldTPFVWVVVLATSLGLLLSFTRARTLegAGASKIGTLLLYFLIACIGMQMDLLALLD-RPWLFLLG 333
gi 81786064 242 ----QIGTGI-----NAMTWTILIVSIVGLLLALTPFASI--PGSMDIGRVMLYTIVAIIASGADFSSIGE-IPVYIIAG 309
gi 81485519 241 ----NAFASVglevfDKGTMTTVFVTILGLVCALTPLGKL--PAVEELSTVYLYAVVSLLASTASVVDLLT-APMWIVYG 313
gi 81341903 242 ifshPLLTGT-----LGDQYLVLTSLTVLIIFLFPRFFERl-NGSQELGTFLIYLFFVVIGIPADLRLIVTnAPLILLFV 315
gi 75171548 296 --------KI-----QGVMLPAVTAITIVLATSFPDFFNSlaPSAETISLILMQVFFTILGATGSVWNVINtAPSIFLFA 362
gi 75180453 314 --------GI-----SGGSLPAITAVVVILATVFPSQFGRlaPSGEAMALILMQVFFTVVGASGNIWSVINtAPSIFLFA 380
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81793385 334 LSWIAVHIVLLLGLGRLLRVPFFYFAIGSQSNIGGPASAPVVAAAFH-PALAPVGVLLGTMGYATGTYLAYLVGITLRAM 412
gi 81786064 310 FMVLLFHGLILFGFAKLFKLDLFTLGVASLANIGGMVSAPVLAGAFN-RALIPVGVIMALIGGFMGTWFGVLTAEILSRL 388
gi 81485519 314 LFILAIHVVLMFVLSKMFHWDLCMVSTASLANIGGSASAPIVASAYN-PSYAGIGVLMGVLGAAVGNFFGIGIGQILKML 392
gi 81341903 316 FIIAISNLAVSLAAGKLFRVRLEEILLAVNATVGGPTTAAAMAIAKGwRELVAPIMLVGTLGYLIGNYVGTFMGNWFSSF 395
gi 75171548 363 AIQVMVHLAVTLVLGKLFCIDMKLLLLASNANIGGPTTACAMATAKGwTSLVVPGILSGVFGVSIATFLGIGCGVFVLKR 442
gi 75180453 381 LVQIGTHLAVILGIGKLLNIELRLLLLASNANVGGPTTAAGMATAKGwNSLIVPGILAGIFGIAIATFIGIAFGVKVLKF 460
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap