Conserved Protein Domain Family
Zea_mays_MuDR

?
pfam05928: Zea_mays_MuDR 
Zea mays MURB-like protein (MuDR)
This family consists of several Zea mays specific MURB-like proteins. The transposition of Mu elements underlying Mutator activity in maize requires a transcriptionally active MuDR element. Despite variation in MuDR copy number and RNA levels in Mutator lines, transposition events are consistently late in plant development, and Mu excision frequencies are similar.
Statistics
?
PSSM-Id: 114639
View PSSM: pfam05928
Aligned: 4 rows
Threshold Bit Score: 337.092
Threshold Setting Gi: 75319677
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75166476   1 MDFPPSKVVADAVEAARAAAVAASEARCAVFVAEKEAKAAVQFAAIVVDKVEAVKASSNVDLVDFKYHVNIKNSLRYAIQ 80
gi 75166478   1 MDFPPSKVVADAVEAARAAVVAASEARCAVFVAEKEAKAAVQFAAIAVDKVEAVKASSNVDLADFKYHVNIKNSLRYAIQ 80
gi 75319677   1 MDCPPSKVVADAVEAARAAAVAASEARCAVFVAEKEAKAAVQFAAIAVEKVEAVKASSNVDLVDFKYHVSIKNSLRYAIQ 80
gi 75319146   1 MDCPPSKVVADAVEAARAAAVAASEARCAVFVAEKEAKAPVQFAAIAVDKVEAVKASSNVDLVDFKYHVNIKNSLRYAIQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75166476  81 EMRRQYKLLHSVQKLCSTIPEVQGGKIGKVRGHLEHVCKELDKTSIVCEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160
gi 75166478  81 EMRRQSKLLHSVQILCSTIPEVQGGKIGKVRGHLEHVCKELDKTSIVCEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160
gi 75319677  81 EMRRQSKLLHSVQKLCSTIPEVQGGKIGKVRGFLEHVCKELDKTSSICEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160
gi 75319146  81 EMRRHTKLLHSVQKLCSTIPEVQGGKIGKVLGHLEHVCKELDKTSIVCEEDLETKNPTWDLYDNPSVDDEHPLDDDELGD 160
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*..
gi 75166476 161 GYSTEDPELWEMAFEDFKWEEIKANVSFEEHNRLINYRFEEINDRNM 207
gi 75166478 161 GYSTEDPELWEMVFDDFKWEEIKANVSFEEHYRVINYRFEEINDRNM 207
gi 75319677 161 GYSTEDPELWEMVFDDFKWEEIKANVSFEEHYRVINYRFEEINDRNM 207
gi 75319146 161 GYSTEDPELWEMVFEDFKWEEIKANVSFEEHYRVINYRFEEINDRNM 207
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap