Conserved Protein Domain Family
DUF919

?
pfam06034: DUF919 
Nucleopolyhedrovirus protein of unknown function (DUF919)
This family consists of several short Nucleopolyhedrovirus proteins of unknown function.
Statistics
?
PSSM-Id: 114740
View PSSM: pfam06034
Aligned: 19 rows
Threshold Bit Score: 61.0974
Threshold Setting Gi: 82027124
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 82015364   75 SKDESLRQKLNQILQTKKQLSIQMQHWERIKRITKDPQEVANIDEKLFRMRMEFLKFSTNNF 136
gi 123860375  19 SQNDSLREQLNAIVAAKKNLNIKMQHWEKLKRITKDPQEIAAIDSELNKLRMEFLSFSVKKF 80
gi 123801476   8 DNGQSLTKQLDKINEHKRKIAVESQHFEKIYKLTKNTSELKNLEHRVMESRQNFLNFGVKHF 69
gi 81961240   25 TTCTTLERQINDIVATKRRLKIKMQHLERLKLITKNEIERRDLDRRLFEIRMNFLEYAHLKF 86
gi 81957684    6 KKNLNIAQQLYDITQAKRQLTIKQTHYERLKRITKDAKELQEIEQQLHQIRMDFLKYSTTMF 67
gi 123881245  18 NRQPDVRQQYQHVMQMKRRLEIQTSHDEKLKRLTKCPKEIERLNDKINTARINFLNYGVNNF 79
gi 82013456   17 NKQQSLKSQLDELNRIKHQARVKLSHEERLLKMEKYP---QQQENRLNALRNDYLKKIVDRL 75
gi 81981658    7 DCNQCLREELNRIIQTKKRLAIKMEHWERIRRITKNARELREIDRTLAEMRMEFLKFGEKHF 68
gi 81952543   20 SKDEDLRRQLNQILQAKRQLTIQMEHWERIKRITKDPKEVQDIESKLLKMRMDFLNFSTDKF 81
gi 123852222  38 SNDDNLRKKLNEILQAKKQLSIQMEHWERIKRITKDPREVADIECKLNKIRNDFLNFGSKNF 99
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap