Conserved Protein Domain Family
MiaE

?
pfam06175: MiaE 
tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)
This family consists of several bacterial tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE) proteins. The modified nucleoside 2-methylthio-N-6-isopentenyl adenosine (ms2i6A) is present at position 37 (3' of the anticodon) of tRNAs that read codons beginning with U except tRNA(I,V Ser) in Escherichia coli. Salmonella typhimurium 2-methylthio-cis-ribozeatin (ms2io6A) is found in tRNA, probably in the corresponding species that have ms2i6A in E. coli. The miaE gene is absent in E. coli, a finding consistent with the absence of the hydroxylated derivative of ms2i6A in this species.
Statistics
?
PSSM-Id: 114868
View PSSM: pfam06175
Aligned: 6 rows
Threshold Bit Score: 296.694
Threshold Setting Gi: 81771186
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81587380   3 QLLAPVHAFLRCETPQTWIDVARASASLDELLIDHCNCELKAAQTAMFLLRRYAlnaesgqsllawakpyeefvyhkdrd 82
gi 81623078  11 QLLEPINHFLQCPTPDEWVEEARKPENLRVLLLDHLLCELKAGQSAMFLIRKYAvdkeselslldwfkpyedfayrk--- 87
gi 585485    21 QILSPVLNFLHCPTPQAWIVQARDPQNLPLLLTDHLICELKAAQTALLLVRKYVadksgadallswlqpyeafafrq--- 97
gi 81622421   4 TMLPEIDQFLACSTPAAWVEAALERQ--DVMLLDHKACEMKAAATAMQLIGKYS-------------------------- 55
gi 81742308  14 IETPVRIKFLLQPTRREWVEQA--IAHLDTILLDHSHCERKAAGVAINLMFRY--------------------------- 64
gi 81771186   3 TPVLPKINVLKQTTSEAWIEQA--IANLDIILLDHSHCERKAAGVALNFMFRY--------------------------- 53
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81587380  83 ieqflardvkknelvavlqpnqhfSFAQDLIPPLIRLIKEEFHHFEQVLELMHARQIPYRNIRAGRYAKGMMSHVTTHEK 162
gi 81623078  88 -igdiqslkgksqiskaiiaksdsPYSQDLIDKMVLLIKEELHHFYQVLEIMQARNVEYESIPASRYAKSLLAHMKTHEP 166
gi 585485    98 -gpepdfvalhkqisksampqtddPWGRQLIDRMVLLIKEELHHFWQVREVMQARNIPYVKITASRYAKGMLKAVRTHEP 176
gi 81622421  56 -------------------------GRLDLVNKMSRLAREELRHFEQVLAILKKRGIRVVNVSASRYASALRDLVRKQEP 110
gi 81742308  65 ------------------------PSHKPLVNALTDIAQEELDHFRQVNQQLERRHIALAPLSPPPYASRLNAAVRQQEP 120
gi 81771186  54 ------------------------PSNTKMVRELTAIAREELEHFELVNQWLERRNIPLAPLPPPPYGAGLKAAARTNEP 109
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81587380 163 NILRDKLIVGAYIEARSCERFAKLAPYL-DAELSKFYVSLLRSEARHFEDYLKLAQLVSSE-DISERVAYFGEREAELIM 240
gi 81623078 167 QTLIDKLIVGAYIEARSCERFAKLAPYL-DDEIAKFYVSLLRSEARHYQDYLQLAEQIAGY-DISERVAYFGRVEAELIS 244
gi 585485   177 LTLIDKLICGAYIEARSCERFAALAPWL-DEDLQTFYLSLLRSEARHYQDYLALAQQISAE-DISARVRYFGEVEADLIL 254
gi 81622421 111 QRLTDTLVVGAFIEARSCERFAALVPHL-DAELAKFYGGLLKSESRHFQDYLKLAYQYGDEaDVERTIEVVRAKEAELIS 189
gi 81742308 121 QRLLDRLLVCALIEARSHERLQLLAQHCpEGELAAFFASLVTSEARHYGTYWSLAYGSFGQeVVAERLQQLAALESEILS 200
gi 81771186 110 ERFLDSLLVTGLIEARSHERLGLLATHCpEPELAKFYKGLMASEARHFGTYWVLADTYFDReIVSQRLDELAIVESELLE 189
                       250
                ....*....|
gi 81587380 241 APDDEFHFHS 250
gi 81623078 245 TPDSDFKFHS 254
gi 585485   255 SPDREFRFHS 264
gi 81622421 190 SPDNEFRFHS 199
gi 81742308 201 TPYPLPRMHS 210
gi 81771186 190 NLHPEPRIHS 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap