Conserved Protein Domain Family
EutQ

?
pfam06249: EutQ 
Ethanolamine utilisation protein EutQ
The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine. The role of EutQ in this process is unclear.
Statistics
?
PSSM-Id: 114941
View PSSM: pfam06249
Aligned: 4 rows
Threshold Bit Score: 247.486
Threshold Setting Gi: 81509350
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81767624   4 ISKELLEKLVRQIIEEKLAgaGNNDSVDFIRNKDKSGIMSIKLptVKVDESNRLDTGNPRDVVYTKDLFTLEESPRLGAG 83
gi 81485014   1 MDKELLEELIRKVIKEELG--KAEQSESEYKQMDKSGIGVVKL--NQMKKRVKMDTGNPKDQVTTTDLFTLQESPRLGAG 76
gi 6685416   85 FTESLVAQLMEKVMKEKQSleQGAMQPSFKSVT---GKGGIKVidGSSVKFGRFDGAEPHCVGLT-DLVTGDDGSSMAAG 160
gi 81509350   4 ISKELIEQLVKQVVLEKMGqsS--------KHVDPSGILSVKLpvVKVSEEDRLDTGNPSDVVYTKDLVTLEESKRLGFG 75
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 81767624  84 IMEMKETTFDWTLNYDEIDYVIEGHLDIIIDGRKISADAGEIILIPKGSKIQFSVPDYARFIYVTYPADWAS 155
gi 81485014  77 LMEMKETTFPWTLTYDELDYIIEGRLEILIDGRKVVGEAGDVILIPKNSKIEFSVPNYAKFLYFVYPANWSE 148
gi 6685416  161 FMQWENAFFPWTLNYDEIDMVLEGELHVRHEGQTMIAKAGDVMFIPKGSSIEFGTTSSVKFLYVAWPANWQS 232
gi 81509350  76 LMEMKDTTFDWFLDYDEVDYVIEGRLDVVIDGRTVSAGPGEIIFIPKGSQIKFSVTGEARFIYVTYPADWQS 147
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap