Conserved Protein Domain Family
CgtA

?
pfam06306: CgtA 
Beta-1,4-N-acetylgalactosaminyltransferase (CgtA)
This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni.
Statistics
?
PSSM-Id: 114995
View PSSM: pfam06306
Aligned: 2 rows
Threshold Bit Score: 620.126
Threshold Setting Gi: 75408568
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75488943   1 MLFQSYFVKIICLFIPFRKIRHKIKKTFLLKNIQRDKIDSYLPKKTLVQINKYNNEDLIKLNKAIIGEGHKGYFNYDEKS 80
gi 75408568   1 MLFQSYFVKIICLFIPFRKIRHKIKKTFLLKNIQRDKIDSYLPKKTLIQINKYNNEDLIKLNKAIIGGGHKGYFNYDEKS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75488943  81 KDPKSPLNPWAFIRVKNEAITLKASLESILPAIQRGVIGYNDCTDGSEEIILEFCKQYPSFIPIKYPYEIQIQNPKSEEN 160
gi 75408568  81 KDPKSPLNPWAFIRVKNEAITLKASLESILPAIQRGVIGYNDCTDGSEEIILEFCKQYPSFIPIKYPYEIQIQNPKSEEN 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75488943 161 KLYSYYNYVASFIPKDEWLIKIDVDHIYDAKKLYKSFYIPKNKYDVVSYSRVDIHYFNDNFFLCKDNNGNILKEPGDCLL 240
gi 75408568 161 KLYSYYNYVASFIPKDEWLIKIDVDHYYDAKKLYKSFYIPRKNYHVISYSRIDFIFNEEKFYVYRNKEGEILKAPGDCLA 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75488943 241 INNYNLKWKEVLIDriNNNWKKATKQSFSSNIHSLEQLKYKHRILFHTELNNYHFPFLKKHRAQDIYKYNWISIEEFKKF 320
gi 75408568 241 IQNTNLFWKEILIE--DDTFKWNTAKNNIENAKSYEILKVRNRIYFTTELNNYHFPFIKNYRKNDYKQLNWVSLDDFIKN 318
                       330       340
                ....*....|....*....|....*..
gi 75488943 321 YLQNINHKIEPSMISKETLKKIFLTLF 347
gi 75408568 319 YKEKLKNQIDFKMLEYKTLKKVYKKLT 345
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap