Conserved Protein Domain Family
DUF1057

?
pfam06342: DUF1057 
Alpha/beta hydrolase of unknown function (DUF1057)
This family consists of several Caenorhabditis elegans specific proteins of unknown function. Members of this family have an alpha/beta hydrolase fold.
Statistics
?
PSSM-Id: 115027
View PSSM: pfam06342
Aligned: 6 rows
Threshold Bit Score: 443.813
Threshold Setting Gi: 21264144
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21264144  37 LIKTVNVTYKTGVNLEETTTVESKYVDVTPSSNTKGTVVTLSGSPGTHNDFKYMKSFFEQKKIRLICTNYPGSEFVTGGL 116
gi 75023162  15 EPKLYSKLVQFQTKRGRLVDLNAVYEDTSASGSPLGTVIGFHGTPGSHKDFKYVRQRLEHMNIRFIGINYPGFKQTPAYP 94
gi 75023164   3 EPNLCRKLVKFETESGKKVELDAVYEDSLTSGSPFGTVVAFHGSPGSHNDFKYIRSKLDDLKIRFIGVNYPGFTFTNEYP 82
gi 75023163  11 EPKLLKKLVKFQAENEQFVELEAVYEDSITSGSPFGTVVAFHGSPGSHNDFKYIRSKLDDLNIRFIGVNYPGFSNTPEYE 90
gi 74957179  29 EPNMHRKLVKFQAENGKQVEVQAVYEDSLSTGSSVGTVVAFHGSPGSHNDFKYIRQQFDEAGIRFIGLNYPGFKQTDGYP 108
gi 74960137  20 LCKTVFVTYKAGPGLKKIVTVQAQYVDICNKPNVRGTVVSLPGSPGSHNDIKYMRDSFEKHNIRLICVNWPGSEFVTGGM 99
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21264144 117 HNSYTNQDRNSYMKSLMETLELKnvNRLIIMGHSRGGENALQLTSMLsndenwPLVGAVMINSPGFAPHKGISK--RMGT 194
gi 75023162  95 GQHFGNWERNSYSEALLNELDVQ--GKVIIMGHSRGCESALITATNR------KPHGLVMVNPTGLRIHKGSRPkgKLES 166
gi 75023164  83 DQKHINIERQNYSNALLDELGID--GKMAYIGHSRGCENALQTAVAR------DAHGIVLINPTGLRIHKGINPisRMTT 154
gi 75023163  91 GQQHANPERQNFSNALLDELKID--GKIIYMGHSRGCENALQTAVGR------EAHGLVLINPTGFRHHQGIRPfyRLEY 162
gi 74957179 109 GQGHCNKERQNYTDAFLKSADLS--GKVIFLAHSRGCENALMTATTF------PAHGLVMMNPLGLRKHKSIRPlsRLER 180
gi 74960137 100 NDTYTNAERNSYAKALMEKLELKkvEKLILLGHSRGGESALQLACTLsddrswPLIGAVMLNSPGFVVHRGISI--RMGT 177
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 21264144 195 INFIISLIKRhnKTINSIlhpilhYFYNNLIGLRVSHGKVAAAAILPMQTFAFDEQKLSIDDLRAKPgIRAFYGYGSKDF 274
gi 75023162 167 LVYFHKKLPK--TVGDTIm-----YNLMKSVGFKIQDGEEAVAVIRAIMNCDLEKQLEYILKLNEQP-TKTMITFGGSDH 238
gi 75023164 155 VDSIYKMLPL--FLGNAMm-----LGVYKAFGFKITTGEEAVNSMRSMINVSLGGQLEFIEKTNDMN-VKKLIVFAGKDH 226
gi 75023163 163 LDWMYGLLPS--FLGNSMi-----LGIYKAIGFKVKSGEEAMCAMRSVMRMSLEDQIEYIEKLNQKH-TKKLIVFGGNDH 234
gi 74957179 181 IEWVYDMLPK--FLADAMi-----YRMYLSFGLKVQDGEEAISALRSVIRCGLETTLPNIHKLREQD-TKTFIIFAGKDL 252
gi 74960137 178 INTVSFLVKLrwKIVDCIlfpvldWFYNDFVGLRVSDGKVCAAAMLPMQTFAFEEQRASIDEMKKKPwIRMFYAYGSKDF 257
                       250       260       270       280       290       300       310
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 21264144 275 LIDEHQSEEVAMYFSEEDHYVIsNKQDAEKAIKEARKSFTtGKQFVTANFKEEGHFLQKTYPEFIVEVVDSIFD 348
gi 75023162 239 LIEKEIVFEALKKYQGLAHFNF-KANITESEKQKIMESFK-NQKGTSVFIAKDNHFQNKKRADLLADAARSMLL 310
gi 75023164 227 LVEEEIVFETLEKHEGLQHFNI-DKEISEAERLKILDSFTgTQRGASVFVAQDNHFQNKSRAGLVAEACKAMFE 299
gi 75023163 235 LVEEEIVLEKLEKHDGLEHFRF-EDGISEEEKSKIMECFTgNQLGASVFVAKDTHFQNKSQAELVAESCKKMLD 307
gi 74957179 253 ICEDEIVFEALKEYRDLVHFDY-DSEIPTDDYGKILKTFDs-EKGASVFVAKDTHFQNKKRADLVAEVVKKIFD 324
gi 74960137 258 LVDESDSEELAMHFGG-DHYIIhSKKESEETIPKIWNSYErGQSYVTANFTEEGHYLHKTYPEFLIQIFGGIFD 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap