Conserved Protein Domain Family
DUF1139

?
pfam06599: DUF1139 
Protein of unknown function (DUF1139)
This family consists of several hypothetical Fijivirus proteins of unknown function.
Statistics
?
PSSM-Id: 115269
View PSSM: pfam06599
Aligned: 3 rows
Threshold Bit Score: 436.62
Threshold Setting Gi: 82043373
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81961936    1 MNYTLGDHYASMyrsaplEFDphdpEINlVNQEFDEDDYTDLDVNLLSDDLSRLNLIAT-RIKNAPEYTAEIFDSFDVPL 79
gi 82043373    1 MEQNQNEEFLVY------EFD----QIN-VNADQQEVDLDDQSVVLSTYEFPSFYDMAVdAISKDFNSTHLIMEELDGVN 69
gi 120407026   1 MDSERHYEYGSYsnshgiEFDpnhpYIDlINDDFDENDYLDLETLNLEADYDDVESLAL-RLKNAPDYTTEIFEKIDRIP 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81961936   80 PFAELLDQEIGEEWCDTSNFMDLRIVEDEnDFEFVSSHITRHLLIVLNSNPNVLWTSTCLLAKLSLIQHVNN-FDVINYW 158
gi 82043373   70 VIYDIFDSEALEKWLDIDTYFELKPFPIE-RFELFNRLLLHQFQTLAYNRPRASWSTLRNQATQSVIEGFEDeFSDLPIQ 148
gi 120407026  80 NFVYLFETEIIDNWNDYDLFADLRVTDTSdEFYTLSSMLTEHMQSIITLLPSILWPMVSQLTKSNVFQAADD-VNITNYW 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81961936  159 EAMNRRWEIITDELKMGFVFRAFNLKSNQFEVVTKLLSDSLFCPGISVIGKLSMIPMLTVHSIPEYLDHWFRTDDFSSDN 238
gi 82043373  149 GMHNESWECLAPELRICFMFRSFKIKPSILLQVSRILAGSLMFPGLNLIGKKSLLDMFNNYNVIEYLDHYFPTSKYDSDE 228
gi 120407026 159 RLMDRRWDFIDEQLRVQFIFRAYDLRAYQNGRVSQILSNSLLFAGLNLIGKRSCIPINSNFSIPDYLDYWFPTDDYHSDN 238
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81961936  239 FLSFIRFgEITVPKWKKVVVQFYLRQVFS--RVRTKV-------LIANTDVDYWYSLFMQTLIFESMLRTKTLIKKILNS 309
gi 82043373  229 YLKFIRF-DLVPDEWKLIVVKHEFENSFRflNVHGKTeekpyhkAMRGPPPDQWYTLLRRKFIFRSLKYTKRLIRNLLDY 307
gi 120407026 239 YLIFIKFnETKNSGWKKIVVQYYLRKVFS--KIRTGI-------LIAHIDVDFWYNVFMRTLVRKEMIHTKNLIKSVLNF 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap