Conserved Protein Domain Family
TRI12

?
pfam06609: TRI12 
Fungal trichothecene efflux pump (TRI12)
This family consists of several fungal specific trichothecene efflux pump proteins. Many of the genes involved in trichothecene toxin biosynthesis in Fusarium sporotrichioides are present within a gene cluster.It has been suggested that TRI12 may play a role in F. sporotrichioides self-protection against trichothecenes.
Statistics
?
PSSM-Id: 115279
View PSSM: pfam06609
Aligned: 2 rows
Threshold Bit Score: 1208.35
Threshold Setting Gi: 74638377
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74638377   1 MTVVVPEEGLDLESQPDDRMRAKALATSAAELPDGYYRSPRIVASFAAFSMNVVATYFVLQASASALPNILQDVGQSENS 80
gi 74629929   1 MTATVHEKGVDLESQPDDRLRAQALATTADELPEGYYTSPRVIASFAGFSLNVCATYFVLQASASALPNILQDIGQSENQ 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74638377  81 SLFSTLWTTGQAVSILMMGRLTDRFGRRPFVILTHILGLVGAIVGCTATKFNTLLAAMTMLGVAAGPAGASPLFIGELMS 160
gi 74629929  81 GLFSTLWTMGQAVSILVMGRLTDRFGRRPFVIATHIIGLVGAIVGCTANKFNTLLAAMTLLGVAAGPAGSSPLFVGELMS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74638377 161 NKTKFLGLLIVSAPVVATNgLSPYLGQRLAIQGSWRWIFYIYIIMSTIAVTLIIIWYYPPSFAQLHGKKVSKREELAKVD 240
gi 74629929 161 NKTKFLGLLTVSIPTIVMS-AGPYFGQRLSIQGNWRWIFYIYIITSAIAVLLIVVWYHPPSFRQLHGKKARKRDELAKLD 239
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74638377 241 WIGIILVIAGTSLFLLGVSWGGQPNNPWNSAKVIGLISSGAGTLVIFALYEVYGKPERPMVPPSLFKDTRGFVCILIISS 320
gi 74629929 240 WIGIFLVSVGVSLFLLGVSWGGKPNSPWNSSKIIGLMTSGLGSLVVFALYEVFGKPVQPIIPPALFKDTRGFVCILLISS 319
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74638377 321 IMGSMHLSLVIMYPQQVVNIFGSSLKNWEETAWMSATASFGTGAGVVVLGSLFHLVRHIRWQILVGAMWLTAFLGAMSSI 400
gi 74629929 320 IMGAMNLCLTIIYPQQVINIFGSSLKNWQETAWMTATASFGTWAGVMILGNVFHLIRHIRWQILVGALWLTAFLGAMSSV 399
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74638377 401 NRDNKNSAIALSVMTGFVVAWAQDITMLLVQFITTDENLGVAFAVVAAARPFAGSIFTAAFISVYTNRYPRELATHLSSA 480
gi 74629929 400 NRDNKNAAIALSFFSGFVVGWAQDITMLMVQFITTDEDLGVAFSVVAASRPFFGSIFTAAFISLYSNQYPKEIGSHLTSA 479
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74638377 481 LRGTGFPQGSFSSLLEAAKSGRMEAVNALPGMTTEISSVVSQAMADSYTASYANVYYFAMALGVIPIIASLCMRDLDCYL 560
gi 74629929 480 MRGTDIPQASFPSLLEAATTGRIDAVKALPGMTNSIAAVVSRAMADSYTASYANVYYFAMALGVIPIIASLCMRDFDRYL 559
                       570       580       590
                ....*....|....*....|....*....|....*...
gi 74638377 561 TDHVPHQLYDRKNAHKDVLEGNSESQPSPIILSMADKE 598
gi 74629929 560 TDHVPHQIYDRKKADKDVLDGDSDTPSSPTIHSTVEVK 597
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap