Conserved Protein Domain Family
DUF1147

?
pfam06615: DUF1147 
Protein of unknown function (DUF1147)
This family consists of several short Circovirus proteins of unknown function.
Statistics
?
PSSM-Id: 115285
View PSSM: pfam06615
Aligned: 3 rows
Threshold Bit Score: 89.3366
Threshold Setting Gi: 81982036
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*....
gi 81924309  1 MYTSLWGHLGVVKANGLLILQTRKPHTGNHLKTSGGMVTMVKKWLLLMTFMAGCRGMIY 59
gi 81982036  1 MSTSLWGHLGVVKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY 59
gi 81982027  1 MYTSLWGHLGVAKANGLLILQTRKPHTGNHLETSGGMVTMVKKWLLLMTFMAGCRGMIY 59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap