Conserved Protein Domain Family
DUF1148

?
pfam06618: DUF1148 
Protein of unknown function (DUF1148)
This family consists of several Maize streak virus proteins of unknown function.
Statistics
?
PSSM-Id: 115288
View PSSM: pfam06618
Aligned: 2 rows
Threshold Bit Score: 206.465
Threshold Setting Gi: 81923479
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75556312   1 MRSHTPPEGTVIMVVPACWSVWIWRDGLSALLPALFSPAEEGFFLETRLFQFESSPRFLLDVDMADCLSRAWNKWPGIAL 80
gi 81923479   1 MRSHTPPEGTVIMVVPECWSVWIWRDGLSALLPALFSPAEEGFFLETRLFQFESSPRFLLDVDMADCLSRAWNKWPGIAL 80
                        90       100       110
                ....*....|....*....|....*....|....
gi 75556312  81 TWWCWYIRDRVAPIHSLSTKYQLLRGSALASLQN 114
gi 81923479  81 TWWCWYIRDRVAPIHSLSTKYHLLRGSALASLQN 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap