Conserved Protein Domain Family
Etmic-2

?
pfam06670: Etmic-2 
Microneme protein Etmic-2
This family consists of several Microneme protein Etmic-2 sequences from Eimeria tenella. Etmic-2 is a 50 kDa acidic protein, which is found within the microneme organelles of Eimeria tenella sporozoites and merozoites.
Statistics
?
PSSM-Id: 115333
View PSSM: pfam06670
Aligned: 2 rows
Threshold Bit Score: 573.821
Threshold Setting Gi: 74834941
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74828465   1 MARALSLVALGLLFSLPPSSAVRTRVPGEDSFSPESGVLSGTDAPERRPnamrtcvttfcvraVVPGLVEGNCGRLTVRN 80
gi 74834941   1 MARALSLVALGLLFSLPPSSAVRTRVPGEDSFSPESGVLSGTDAPERRP--------------IVPGLDEGNCGRLTVRN 66
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74828465  81 GLSVDETIKVTSAGWTKSERDFIVSLVADETRKVVQLRESEGASGASGPGPAPAEKPPSGQGSAEEAPKGEGGQEKPSVP 160
gi 74834941  67 GLSVDETIKVTSAGWTKSERDFIVSLVADETRKVVQLRESEGASGASGPGPAPAEKPPSGQGSAEEAPKGEGGQEKPSVP 146
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74828465 161 LIAVRIHGSGGDKGESAPQSAVLLYGNDESEPTEVPLETAAGPTTPLMVLITQQNPKEVEVRVLAWISTeylcsrrgvsr 240
gi 74834941 147 LIAVRIHGSGGDKGESAPQSAVLLYGNDESEPTEVPLETAAGPTTPLMVLITQQNPKEVEVRVLAWIST----------- 215
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 74828465 241 ifkysdfcslcrDATTGKGSWKENSVVVGSSLSGRDLTVNLSDCGPSSLRVYGSASADLVTVKEGMCEADDPELIALTRP 320
gi 74834941 216 ------------DATTGKGSWKENSVVVGSSLSGRDLTVNLSDCGPSSLRVYGSASADLVTVKEGMCEADDPELIALTRP 283
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 74828465 321 HTSAASPLPAEEGDVAQDAQQSAGAQQEAEVQEVGEPQQEAAAAEQGSSAAESDTQQSS 379
gi 74834941 284 HTSAASPLPAEEGDVAQDAQQSAGAQQEAEAQEVGEPQQEAAAAEQGSSAAESDTQQSS 342
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap