Conserved Protein Domain Family
DUF1299

?
pfam06975: DUF1299 
Protein of unknown function (DUF1299)
This family represents a conserved region approximately 50 residues long within a number of proteins of unknown function that seem to be specific to Arabidopsis thaliana. Note that many family members contain multiple copies of this region.
Statistics
?
PSSM-Id: 115620
View PSSM: pfam06975
Aligned: 4 rows
Threshold Bit Score: 75.0912
Threshold Setting Gi: 75335090
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*..
gi 75336164 498 HDEHDEIEDQEEYAILSDDENNGTAPTEKESHPLKEKTTEVPKEETV 544
gi 75335090 552 HDEHDETEDQEAYVILSDDEDNGTAPTEKESQPQKEETTEVPRETKK 598
gi 75337249  14 HDEYNDVADQEAYINLSDDENNDTAPIEKESQKKKKET-NVLKEESV 59
gi 75318863 331 HNEYNDAADQEAYVILSDNEDNGTAPTEKESQPQKEETTEVPKEENV 377
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap