Conserved Protein Domain Family
DUF1324

?
pfam07038: DUF1324 
Protein of unknown function (DUF1324)
This family consists of several Circovirus proteins of around 60 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 70500
View PSSM: pfam07038
Aligned: 2 rows
Threshold Bit Score: 85.5676
Threshold Setting Gi: 81924308
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....*....
gi 81924308  1 MKCTLVFQSRFCIFPLTFKSSASPRKFLTNVTGCCFATVTRIPLSNKVLTAVDRSLRCP 59
gi 81922320  1 MTCTLVFQSRFCIFPLTFKSSASPRKFLTNVTGCCSATVTRLPLSNKVLTAVDRSLRCP 59
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap