Conserved Protein Domain Family
PRRSV_2b

?
pfam07069: PRRSV_2b 
Porcine reproductive and respiratory syndrome virus 2b
This family consists of several Porcine reproductive and respiratory syndrome virus (PRRSV) ORF2b proteins. The function of this family is unknown however it is known that large amounts of 2b protein are present in the virion and it is thought that this protein may be an integral component of the virion.
Statistics
?
PSSM-Id: 115705
View PSSM: pfam07069
Aligned: 2 rows
Threshold Bit Score: 105.404
Threshold Setting Gi: 81975700
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 81975700  1 MGSMQSLFDKIGQLFVDAFTEFLVSIVDIIIFLAILFGFTIAGWLVVFCIKLVCSAILRTRPAIHSEQLQKIL 73
gi 81947590  1 MGSMQSLFDKIGQLFVDAFTEFLVSIVDIIIFLAILLGFTIAGWLVVFCIRLVCSAVLRARPTVHPEQLQKIS 73
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap