Conserved Protein Domain Family
DUF1363

?
pfam07101: DUF1363 
Protein of unknown function (DUF1363)
This family consists of several Trypanosoma brucei putative variant specific antigen proteins of around 80 residues in length.
Statistics
?
PSSM-Id: 115736
View PSSM: pfam07101
Aligned: 2 rows
Threshold Bit Score: 220.366
Threshold Setting Gi: 18413555
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18413549   1 MSRHGNIDIGCGAGNTMDATFRSCTPHESFYYLSINHDLKAREAQNNNTNSDTICFSTHLHKRSNRRLDRRCEYIFGICS 80
gi 18413555   1 MSRHGNIDIGCGAGNTMDATFRSCTPHESFYYLSINHDLKAREAQNNNTNSDTICFSTHLHKRSNRRLDRRCEYIFGICS 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....
gi 18413549  81 IKGNSAARRKKFLNTPLCQRYLNNCLKYMHSICHYQTRPGRTSS 124
gi 18413555  81 IKGNSAARRKKFLKTPLCQRYVNNCLKYMHSICHYQTRPGRTSS 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap