Conserved Protein Domain Family
MatC_N

?
pfam07158: MatC_N 
Dicarboxylate carrier protein MatC N-terminus
This family represents the N-terminal region of the bacterial dicarboxylate carrier protein MatC. The MatC protein is an integral membrane protein that could function as a malonate carrier.
Statistics
?
PSSM-Id: 115789
View PSSM: pfam07158
Aligned: 5 rows
Threshold Bit Score: 153.759
Threshold Setting Gi: 81546198
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75415623   1 MpNELTGVLILAAVFLLAGVRGLNMGLLALVATFLLGVVALDRTPDEVLAGFPASMFLVLVAVTFLFGIARVNGTVDWLV 80
gi 75345168   1 M-IHLIMISAIALAIGIGYRTKINIDLLAIAFSYLIATTLMGLSPKELLHFWPTSLFFTIFSVSLFYNFAITNGTLDVLA 79
gi 81546198   1 MsPELISILVLVVVFVIATTRSVNMGALAFAAAFGVGTLVADLDADGIFAGFPGDLFVVLVGVTYLFAIARANGTTDWLV 80
gi 75424898   1 MgIELLSIGLLIAMFIIATIQPINMGALAFAGAFVLGSMIIGMKTNEIFAGFPSDLFLTLVAVTYLFAIAQINGTIDWLV 80
gi 81792679   1 MtPQIATILGLVIMFIVATALPINMGAVAFALAFIIGGVWVGLDGKEVLAGFPGDLFLTLVGITYLFAIAQKNGTIDLLV 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 75415623  81 RVAVRAVGARVGAVPWVLFGLAALLCATGAASPAAVAIVAPISVAFAVRHRIDPLYAGLMAVNGAAAGS 149
gi 75345168  80 QHILYRTRTYPNALYMILYLMATLLSALGAGFFTTMAVCCPLAITLCQKVYKHPLIGAQAVNWGASGGA 148
gi 81546198  81 HAAVRLVRGRVALIPWVMFALTGALTAIGAVSPAAVAIVAPVALSFATRYSISPLLMGTMVVHGAQAGG 149
gi 75424898  81 ECAVRLVRGRIGLIPWVMFLVAAIITGFGALGPAAVAILAPVALSFAVQYRIHPVMMGLMVIHGAQAGG 149
gi 81792679  81 HWAVRAVRGRIVAIPWVMFVITGLLTAFGALGPAAVAIIGPVALRFAKQYRINPLMMGLLVIHGAQGGG 149
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap