Conserved Protein Domain Family
CTV_P33

?
pfam07184: CTV_P33 
Citrus tristeza virus P33 protein
This family consists of several Citrus tristeza virus (CTV) P33 proteins. The function of P33 is unclear although it is known that the protein is not needed for virion formation.
Statistics
?
PSSM-Id: 115814
View PSSM: pfam07184
Aligned: 2 rows
Threshold Bit Score: 581.603
Threshold Setting Gi: 81919958
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81919958   1 MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDIVDRDPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVN 80
gi 81924817   1 MFAFASENQDILEEKIFRRRTCHRKYLDDVVRDFTIDIGYDTVDRDPTVLADYLSLYFFLLNNDYIGPLAASIMVSPPVS 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81919958  81 GTHKIRAHVDNQPNCEGNVTYIKTVDKSRFAILIKAVPAPMRGYYSFRAFLAADVTSERSEFICSFVGSRFLCCCTQTIS 160
gi 81924817  81 GTHKIRAHIDNQPNREGNVTYVKTVDKSRFVIRIKAMPASMRGHYSLRAFLSGDVASATVEFICSFVGSRFLCCGTQTIS 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81919958 161 ENLSKVCSSSFSFRAVSKTAINEFSVAIDDVEDVKYVRKRAEGFSHCADPYPPRCYRGTNLGDSSGVQSRTIEEEGYRTD 240
gi 81924817 161 ENLNKVCSSSFFFRVVSETATNEFSVVTDDVEDVKYVRKRAEGFLHCADPYPPRCYRNANLGDCSGVQSRTIEEEGYRTD 240
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 81919958 241 TAGNVAVSIPNTPLVNAVSPYVAEYNENTRSRISLIRRVCCYAVCVLVVSLLIMSGLLAIIFI 303
gi 81924817 241 TVGNVAVTVPNTPLVNAVSPYVAEYNENARSRISLIRRVCCYAVCVLVVSLLIMSGLLTIILI 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap