Conserved Protein Domain Family
DUF1424

?
pfam07232: DUF1424 
Putative rep protein (DUF1424)
This family consists of several archaeal proteins of around 320 residues in length. Members of this family seem to be found exclusively in Halobacterium and Haloferax species. The function of this family is unknown. This protein is probably a rep protein due to conservation of functional motifs.
Statistics
?
PSSM-Id: 115861
View PSSM: pfam07232
Aligned: 2 rows
Threshold Bit Score: 623.274
Threshold Setting Gi: 140038
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30        40        50        60        70        80
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 140039   1 MASQPeegfGERLRKEVTVDTSRGVRATSTAQAVENFEGWYADQRDTQMVVEEAtTGERVGFRTPNRFTPEYREMLYAKA 80
gi 140038   1 MAKRD----GMKLRDELTFDTSRAVKAVSWGEAIDRFQSWYDDQRGTQIVVENE-LGETVGFDMPNRFTPEYREMLYAKA 75
                      90       100       110       120       130       140       150       160
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 140039  81 QSLERGLREEWGDLLHTAMVTLTASTTEEDGGPRPLVDHLRDLLSSWSAVYDALRHTLEDREFEYLAIIEPTTpagngpA 160
gi 140038  76 QSLERGLRERWGSLLHTGMVTLTASSTDDEGRLRPPLEHFEDLLESWEAVRRALARVLEGREWEYLAILEPHE------S 149
                     170       180       190       200       210       220       230       240
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 140039 161 GYAHIHLGVFVKGPVVAEQFQDVLDAHVKNSEGAGREAHRaVVEDDEDEAAVSIRRSARPDREDGIENLGAYLAAYMAGE 240
gi 140038 150 GYVHIHLGVFVRGPVVAEQFEPVLDAHLRNCPTAGEDAHQ-VFDENGDEDAVRVRRSSHPSRSGGVENLGAYLAAYMAGE 228
                     250       260       270       280       290       300       310       320
              ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 140039 241 YGVEALAMPAHVRAFYAAMWATGTQWFRPSNGAQRHMQPES-DDEESVEEWEMVGIAPEGDLEDeIIEVDPEQPRDDPYR 319
gi 140038 229 YGSEPSEMPENVRAFYATMWASGRQWFRPSNGAQELMQPEEdDEGDSIEEWEMVGIAPEGDLGD-IIEVDPSEPRSDPYR 307

              ....*....
gi 140039 320 RLRTPPPGG 328
gi 140038 308 RLRTPPPGG 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap