Conserved Protein Domain Family
DUF1442

?
pfam07279: DUF1442 
Protein of unknown function (DUF1442)
This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length. The function of this family is unknown.
Statistics
?
PSSM-Id: 115904
View PSSM: pfam07279
Aligned: 4 rows
Threshold Bit Score: 335.336
Threshold Setting Gi: 75174940
Created: 20-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75206046   1 MKLIWSPETASKAYIDTVKSCENLGTPGAAELVAAMAAGWNANLIVETWSEGETIAISVGLNIASRHTNGRHICIVPNAR 80
gi 75097345   1 MKLVWSPETASDAYIDTVKSCKSDKESGVAEFLSATAAGWNARLIVETWSRGDPITTSVGLAVAATHTGGRHVCIVPDEQ 80
gi 75181367   1 MRLVWSPETASNAYIHTVRSCKSYRDSSVAEFLSATAAGWNTRLIVETWSRGDPIATSVGLAVAAIHTCGRHVCIVPDEE 80
gi 75174940   1 MKLVWSPETASKAYIDTVKSCENLETPDAAELIAAMAAGWNVKLIVETWSEGDAIASSIGLNVASKHANAKHICIVQNSR 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 75206046  81 SQTAYLQAMAEQSCS-NLpeTIImneeGEELEHTMQTLQGIDFLVVDWDQKDFAaNVLRNAVFGSRGAVVVCRSGYRRST 159
gi 75097345  81 SKLEYVLAMRGFVTT-EV--VVV----GESVENTMEEFPGVDFLVVDSKRREFV-RTLRFAKLSNKGAVLVCKNAMHRAI 152
gi 75181367  81 SRSEYEAVMRGAVTS-DSteVMV----LDSAEDVVERISGVDFMVVDSKRHEFV-NALGLAKTSKMGAVLVCKNATLKSI 154
gi 75174940  81 SESAYLQAIQESSSPlNFpeTIV----AEEPGKAMKKLQGVDFLVVDWRNKEFAaAALKNAAFGNRGAVVVCRNGYS--- 153
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 75206046 160 SCFSWTKAF-SDRNVVRTVTLPVSGGLEIAHVAAARSSGKSDnnsNKRKWIKHFDQRSGEEHVIRK 224
gi 75097345 153 SGFKWHDVLkRGTRVVRSVFLPVGSGLDIVHVGATGRGDSRN---LRSRWIRHVDHLSGEEHLFRR 215
gi 75181367 155 PGFKWQGLLrRGTRVVRSVFLPVGRGLEIVHVGASGGGNGLRk--IPSRWIKHIDPRSGEEHLFKR 218
gi 75174940 154 ---SLRRVL-RDRKVVRTVTLPVTGGIEIAHVAARNSGKSGN---NKRRWITHVDQRSGEEHVFSI 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap