Conserved Protein Domain Family
Neuroparsin

?
pfam07327: Neuroparsin 
Neuroparsin
This family consists of several locust specific neuroparsin proteins. Neuroparsins are produced by the A1 type of protocerebral median neurosecretory cells of the PI-CC system and display pleiotropic activities: inhibition of the effect of juvenile hormone, stimulation of fluid reabsorption of isolated recta, induction of an increase in hemolymph lipid and trehalose levels, and neurotrophic effects.
Statistics
?
PSSM-Id: 115951
View PSSM: pfam07327
Aligned: 4 rows
Threshold Bit Score: 142.373
Threshold Setting Gi: 6093528
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6093528    1 MKATAALVAATLLLAVTLFHRAERNPISRSCEGANCVVDLTRCEYGDVTDFFGRKVCAKGPGDKCGGpyelHGKCGVGMD 80
gi 74844883   1 MKPAAALAAATLLIAVILFHRAEANPISRSCEGANCVVDLTRCEYGEVTDFFGRKVCAKGPSEHCND----FIKCGDGLR 76
gi 74844553   1 MKPAAALAAATLLIAVILFHRAEANPISRSCEGANCVVDLTRCEYGEVTDFFGRKVCAKGPGERCSD----YESCGDGLR 76
gi 74844554   1 MKPAAALAAATLLIAVILFHRAEANPISRSCEGANCVVDLTRCEYGEVTDFFGRKVCAKGPGDDCNV----YASCGIGMD 76
                        90       100
                ....*....|....*....|....*..
gi 6093528   81 CRCGLCSGCSLHNLQCFfFEGGLPSSC 107
gi 74844883  77 CNCGRCTGCSMHTLQCY-SDFSTPTTC 102
gi 74844553  77 CAQKLCVGCSLATLQCFsIVSLPLSEE 103
gi 74844554  77 CRNKKCSGCSVKTLECY-FESFPMSEE 102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap