Conserved Protein Domain Family
DUF1472

?
pfam07339: DUF1472 
Protein of unknown function (DUF1472)
This family consists of several Enterobacterial proteins of around 125 residues in length and contains 6 highly conserved cysteine residues. The function of this family is unknown.
Statistics
?
PSSM-Id: 115962
View PSSM: pfam07339
Aligned: 2 rows
Threshold Bit Score: 159.76
Threshold Setting Gi: 487402633
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119368812  74 AWPCGFSVMWPPCRVRAVPCLHLSRAGGDARVRFAAAVTRSLLPVCRDFPVVHPLRFRGLTLQLPSAVCVRLRLPLRPVH 153
gi 487402633  25 AWPCGFSALWPQRRVRAVPCLHLSRAGRDARVRFAAAVTRSLLPVCRDFPVVHPLRFRGLTLQLPPAVCVRLRLPLRPVH 104
                         90       100
                 ....*....|....*....|.
gi 119368812 154 PRLIARLLWRHGTARCRGICE 174
gi 487402633 105 PRLIARLLWRHGTARCRRTCD 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap