Conserved Protein Domain Family
Lenti_VIF_2

?
pfam07401: Lenti_VIF_2 
Bovine Lentivirus VIF protein
This family consists of several Lentivirus viral infectivity factor (VIF) proteins. VIF is known to be essential for ability of cell-free virus preparation to infect cells. Members of this family are specific to Bovine immunodeficiency virus (BIV) and Jembrana disease virus which also infects cattle.
Statistics
?
PSSM-Id: 116023
View PSSM: pfam07401
Aligned: 2 rows
Threshold Bit Score: 362.391
Threshold Setting Gi: 82294409
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 138490     1 MERTLQSVVGRRRGSSNRGRGKNSLISTPSYALHPPPRFRYPRWEFVRQTEYSMTACVRKGKLVLTYQYAIWKRVWTIET 80
gi 82294409   1 MERTIQSPMGRRRGSSGRRKRNANIISPPAYAIYPAPQYRYPRWEFVMNDLYSQTARLQKEEIIITYRYAVWAREWKIQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 138490    81 GFTDPSLFMTPAGTHTTEEIGHLDLFWLRYCSCPHEMPPWLDFLRGTLNlRISCRRALQASVLTSTPRHSLQRLAALQLC 160
gi 82294409  81 GFLDLGYLMTPAGTHTTGELNELDLFWVRYTLCQHRSPKWRELLLGEMT-HTSCRRTAQAAVVSHTKPHTLQRLAGLTLV 159
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 138490   161 TNACLCWYPLGRINDTTPLWLNFSSGKEPTIQQLSGHP 198
gi 82294409 160 CNQNLCWYPVGTVTRNSPLWMHFTTGKEPTIQQLSGHP 197
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap