Conserved Protein Domain Family
Pardaxin

?
pfam07425: Pardaxin 
Click on image for an interactive view with Cn3D
Pardaxin
This family consists of several Pardaxin proteins. Pardaxin, a 33-amino-acid pore-forming polypeptide toxin isolated from the Red Sea Moses sole Pardachirus marmoratus, has a helix-hinge-helix structure. This is a common structural motif found both in antibacterial peptides that can act selectively on bacterial membranes (e.g., cecropin), and in cytotoxic peptides that can lyse both mammalian and bacterial cells (e.g., melittin). Pardaxin possesses a high antibacterial activity with a significantly reduced haemolytic activity towards human red blood cells compared with melittin. Pardaxin has also been found to have a shark repellent action.
Statistics
?
PSSM-Id: 116046
View PSSM: pfam07425
Aligned: 4 rows
Threshold Bit Score: 43.9234
Threshold Setting Gi: 129607
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                      10        20        30
              ....*....|....*....|....*....|...
1XC0_A      1 GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE 33
gi 6225828  1 GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE 33
gi 129607   1 GFFALIPKIISSPIFKTLLSAVGSALSSSGGQE 33
gi 6225826  1 GFFAFIPKIISSPLFKTLLSAVGSALSSSGEQE 33
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap