Conserved Protein Domain Family
NAGidase

?
pfam07555: NAGidase 
Click on image for an interactive view with Cn3D
beta-N-acetylglucosaminidase
This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
Statistics
?
PSSM-Id: 311489
View PSSM: pfam07555
Aligned: 91 rows
Threshold Bit Score: 314.496
Threshold Setting Gi: 0
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5DIY_B           7 RGIIEGFYGKPWEHQERLDMFEFMQANNLNAYIYAPKQDLYHRELWREPYKEEQL-QLFKELIEKAGSCGINFTFAISP- 84
gi 81767118    200 RGFIEGFYGVPWSHEDRMNLMKDTSEYKMNTYIYAPKDDPYHRLSWKELYPEQEA-KQIAELAKAGAENNFNFCWTIHP- 277
19_pfamImport    1 RGFIEGYYGLPWTNEDRMSLMKFGGKIKMTSYVFAPKDDPYHSSKWFELYPEEEL-KKVKEMVEVGRMNKTKFVWTAHPf 79
57_pfamImport    1 RGFIEGYYGIPWSNEDRMSLMKFGGDFKMTSYVFAPKDDPYHKNLWRELYPEEEL-AAIKEMVQVGNDSKCRFVWTAHPf 79
73_pfamImport    1 RGFIEGYYGIPWSNEDRMALMEFGGNFKMTSYIFAPKDDPYHKNLWREEYPQAEL-NEIKKMVEVGLASKCRFVWTAHPf 79
gi 20141530    187 RGFIEGYYGNPWSNEDRAELMKFGGDYKLNQYVFAPKDDPYHNSKWRDLYPEEKL-SEIKKLAQVGNETKNRYVYALHPf 265
61_pfamImport    1 RGFIEGYYGNPWSLEDRIDLMKFGGEIKMNQYVFAPKDDPYHNSQWRELYPTENL-ENIKKLAQAGNENKCFFVYALHPf 79
55_pfamImport    1 RGFIEGYYGNPWSTEDRVNLMKWGGYYKLNAYFYAPKDDPKHRTQWDQLYTEEELaNKIRPLAEAGNESKCRFVYALHPf 80
53_pfamImport    1 RGFIEGYYGNPWSTEDRKKLMEWGGYYKLNSYFYAPKDDPKHNSKWRELYTDEEIeTKIKPLAEAGNKSKCRFVFALHPy 80
39_pfamImport    1 RGAIEGYYGNPWSLQDRINYMRWGSYYKLNGYFYAPKDDPKHSHKWRELYTESEIeNLIKPLAREGNRTKVRYIYTLHPf 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5DIY_B          85 ------GLslvyS---SEEELETLIRKITPFLEMGVHSIGIFFDNVPfdliheedrnsySNLAEAQADFLTRVLQRLEST 155
gi 81767118    278 ------GAtl----qfTDEDFDALINKFEQLYSLGVRQFGVLFDDTDd-----------WRNGQKQAEWINKIDTEFVKA 336
19_pfamImport   80 mssqniGS----DankYEERLAKLIAKFEQLYSIGVRQFGVLADDVG------------SVPRQTVINMMKSLVEWGKKK 143
57_pfamImport   80 m----gGF----NaskVDEEIASLLKKFDQLYDAGVRQFGVLGDDVG------------SLDRSVVIKMMNSVSAWAKEK 139
73_pfamImport   80 m----gGF----DanrVDEEIAALLNKFEQLYAAGVRQFGVLGDDVG------------NLDRNVVIKMMNAVSEWGEAK 139
gi 20141530    266 mnnp----vrfdTeenYQNDLGVIKAKFTQLLENDVRQFAILADDASa----------pAQGASMYVKLLTDLTRWLEEQ 331
61_pfamImport   80 mn-------spfNfnnYNADLATVKAKYLQVIESGVRQIALLEDDAT------------GSSAANLSRLLNDLTNWLTEL 140
55_pfamImport   81 pqgn---hlrfdDn--YEADLAKLQAKFKQVIDQGVRQIAILADDFW------------NPGGPNGVRLLNDMTAWLEEV 143
53_pfamImport   81 myna----irynSeenYQADLKVLQAKFEQVIKAGVRQIAILADDAG------------NVGGANYTKTLTDMTAWLKEM 144
39_pfamImport   81 fgtrldND--------YDQGVKDLKNKFLQVIQAGVRQIGILADDVA------------RADIGTQVRLLIDMVTWLKEL 140
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5DIY_B         156 IST------PQIIMCPTFYCNDP---NLEYLRILGQRLPKNIDVFWTGPNVCsHEITTSHMQ--EVQK------SL-QRP 217
gi 81767118    337 KGDv-----APMIVISARYNSAWgpnMDRYFKPFMQTLHDDIQVMWTGHATM-SNVSKEVFEwpKVQT------GV-DKD 403
19_pfamImport  144 GDV------YDWVFCPAGYNNAWt--DMNELSDYDPQFPPEVHIFWTGNTVC-APIIQDTLN--NFRTrnlragQSkRRA 212
57_pfamImport  140 GDV------YDSVFCPAGYNHSWq-gDYSELSDYDTGFPEDVKIFWTGEAVC-QPVEQKTLD--HFKRnrlpegADeRRS 209
73_pfamImport  140 GDV------YDPVFCPAGYNHSWq-gDYSELNAYDEGFPQNVQIFWTGEAVC-QPVEQKTLD--HFRKhnlpsgKQsRRA 209
gi 20141530    332 QSTypd-lkTDLMFCPSDYYGNG---SSAQLKELN-KAEDNVSIVMTGGRIW-GEVDENFAN--NFMNnistegHP-GRA 402
61_pfamImport  141 KNSkypdlkTDILYCPTDYMGNG---SSAKLKGINASANRQVHMLMTGNAVW-GQVSANFAD--NFYNnvasngVA-GRY 213
55_pfamImport  144 KKQypd-mkMTIPYVPYDYMGNG---SSAELQELK-KAPANVQIVMTGGRVW-GEVTNNFTS--TFTN------NV-GRG 208
53_pfamImport  145 QKTypd-lkLTLPFCTQEYMSNG--------QSYYRNFPANIQIVMTGGRVW-GEVTNNFTT--TFTN------NA-GRG 205
39_pfamImport  141 KQTkyhdlkVVLPFVVNEYAGYG--------QSYFKRFPNEVQIVMTGGKTW-GEVSPEFTN--KFYS------NT-NRG 202
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
5DIY_B         218 ATLWDNYPVNDGgmMPE-LHIGPYD-HRDPELHTh-VVGIYANPMALPEASKLPLYTFAQYLNSP--SQYNPQDSWRQAV 292
gi 81767118    404 VAVWWNYPVNDY--CDSrILMAPLH-NLNQDLDN--VSGFFSNPMNQAEASKVALYSIADYTWNT--DAFDYMKSWETSI 476
19_pfamImport  213 PLFWLNWPVNDI--NKKrLLMGKGE-LLHTDINVedLAGVVSNPMQEAEPSKVALAAIADYSWNV--KNFNADKSWENSF 287
57_pfamImport  210 PLFWLNWPVNDI--NGSrLMMGKGS-LLHTDINIddLSGVVTNPMQEAEASKVAIFAVADYAWNV--KSFNDDQSWADSF 284
73_pfamImport  210 PLFWLNWPVNDI--NMNrLLMGKGS-LLHNNVKPkdLSGVVTNPMQDAHASKVALFAVADFAWNV--SAFDADKSWKDSF 284
gi 20141530    403 PFFWINWPCSDN--SKQhLIMGGNDtFLHPGVDPskIDGIVLNPMQQAEANKSALFAIADYAWNIwdNKEEADENWNDSF 480
61_pfamImport  214 PYMWVNWPCNDN--YKTgLIMGGHNtILHTGIDGhkYEGIILNPMQHSEPSKVAIFTAADYCWKPwdAKEEGDQAWEDSF 291
55_pfamImport  209 PFMWINWPCTDN--SKKhLIMGGYDtFLHPGVEPskIQGIMLNPMQQSEPSKVAIFGNADYAWNIweTKEEADKSWNDAF 286
53_pfamImport  206 PYMWINWPCTDN--SKKhLIMGGYTtFLHPGVDPnkIQGIVLNPMQQSEPSKVAIFGNACYSWNIwqSEEEAQKCWTASF 283
39_pfamImport  203 PLLWINWPCSDN--SKNhLILGGYReFLHKNVDPkkVQGIVLNPVQQSEPSKVALFGAADYTWNIwkDDAHIDQTYSDAF 280
                          330       340
                   ....*....|....*....|
5DIY_B         293 STLLg-----EDNLSAMEKF 307
gi 81767118    477 EKFV------PEVKEEFMRF 490
19_pfamImport  288 KYID------ENVSDSLFRL 301
57_pfamImport  285 KYID------QEASEELHTL 298
73_pfamImport  285 KYID------EDAYEELYTL 298
gi 20141530    481 KYMDhgtaeeTNSSLALREI 500
61_pfamImport  292 KYIDhvtaleSDSSKALREV 311
55_pfamImport  287 SFVDhnsaimNDASDALREL 306
53_pfamImport  284 KYVDhnsaieTQASAALREL 303
39_pfamImport  281 NYVTnnsyqeTAESKAFRNL 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap