Conserved Protein Domain Family
DUF1538

?
pfam07556: DUF1538 
Protein of unknown function (DUF1538)
This family contains several conserved glycines and phenylalanines.
Statistics
?
PSSM-Id: 311490
View PSSM: pfam07556
Aligned: 283 rows
Threshold Bit Score: 149.842
Threshold Setting Gi: 502735521
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121695083  20 ILVILIIhfLFIpdFSISNALVLILGSLMVTLGIALFLVGVNVGLIPIGNAIGSDIPR--SGSIVIILMTTFFLGFLATI 97
gi 75542452   35 TLFLILIqvVLLk-KPIKNIKSLTFGIILTTLGLFLFLEGTSLFLLPLGESVGENLVS--LDNKWLILLLIFIIGFSTTL 111
gi 503144703  26 VLIFLFLnaIALr-LRAPIIKRIMGGFVVTYLGLVLFLQGVNIAFVPAGEFLGTALAE--LEYSWILIPLGFAIGFLVAF 102
gi 504781565  21 AVFLILFqvLFLk-KPMENIKSFALGFLLTILGLHFFLKGLSISLLPLGEDVGRNLLT--LNNKWIIVLFGFVLGYFATL 97
gi 503545499  21 VIFLCIFrlIVLr-KPIEEIKTLALGTLLSIIGLHLFLKGISLSLIPLGDSVGRDLVV--LNNKYLIAIFAFVVGFFATM 97
gi 504620350  21 AIILVLFqlIVLk-KPLRNTREFVIGILLCVFGLHFFLKGVFMSLHPLADSVGGNLVV--LKHKWSIIAAVFAIGYCGTL 97
gi 502959786  23 LIFFAIFqiLYLk-FPRLELVKLIRGIILTAIGMILFLYGVYNGFLPVGQEIGEILGN--FEHKWILMPFGFIMGFLATF 99
gi 502931106  25 VLLFLLVqvFLLk-LPQREVADILKGTAIAAGGLFLFLLGIGIGFLPFGRAVGAALGA--LDRTWLFVLGGLLLGLFTAW 101
gi 498431945  26 ILLFLVMnfLSFq-MSKERFWAIIKGFLITTVGLILFLHGVDLAYVPVGQHLGSVFAS--LEHNQLLIPLGFLMGFLVGF 102
gi 505304717 271 IIFIIMMkyYLHs--SWHDFEMMCLGILLTVVGMIMFLTGVYSGFMPMAQEIGVYLIEdnVG-IWILLL-GLSLGFMVIA 346
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 121695083  98 AEPNVRVLADMIQIVSENSIERLQFIMVISVGGGFFIATSIFRIIYNVPLAYLFSSGYLLVLLLLFFAPPDYVPIAFDAG 177
gi 75542452  112 VEPALATLAAEVEEISIGTISKKVLIYTVAIGFGAGLSAGVYKILYSIQTSKIVIPLLVLSIILCIFAPEEIIGIAFDCA 191
gi 503144703 103 AEPAVQVMVKQVEEMTSGAIKARVMLLAISLGVALAVMTAMIRLLAGISLWWILVPGYILAFILGRFVEPNFLAMAFDNG 182
gi 504781565  98 AEPALRILALEVEEISSGVIRSNMLIQFVALGFGGGMSIGIIKILNNIPNSKIMIPLLGIIILLIYFTPKEFVAVAMDSA 177
gi 503545499  98 VEPGLKSLALEVEEISTGAIPMNVLINAVGIGFGLGMSIGIVKILNNIPTKTILFPVLLLAMILGYFAPREFVDIAIDSA 177
gi 504620350  98 VEPALKTLALEVEEVSIGAIPHKTLIHAVAIGFGIGMGIGIYKILNNISYAKVIIPLLLLILTLIFFTPDEFISIAMDSA 177
gi 502959786 100 AEPAVRVLCYQIEESSSGFIKSNLMIYTLSIGVGVFVAIAMAKLVYGIPFQYIIIPGYILAILLLWLSDKDFIAIAFDAG 179
gi 502931106 102 GEPAVRILADQVEQASSGSIPGSLVLWAICVGVALWVGLGMFRIAYGIPLLYLLVPGYLLAIGLMWLSDRDFVAIAVDAG 181
gi 498431945 103 AEPAIHVMVKQVEELSEGRIKAKIMLAVISIGIGLAVGLSMWRLLVGFSLYYFLIPGYGLAFILGRKVDKIFLAMAFDNG 182
gi 505304717 347 AEPAVKILGSQVEAVSKNMITTNTIIIVVGVGVSVFVGIGMYALSQGWMSIYYILPIYALAIALLWFMDNSLVGITYDAG 426
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 121695083 178 GVTIGSINGPIFLAMGIGVTSILGgrsaISDGFGLIGLASLGSVISILIMGIV 230
gi 75542452  192 SSTTGPVNIPLNLTIALGLSRTLQnsdpLLNAFGIIGLTSMGPVISVLILGIL 244
gi 503144703 183 GVATGPMCSTFILSLSVAVAGATPgrnpLLDGFGVVALIALAPILTTLFLGFF 235
gi 504781565 178 ASTTGPVNIPLNMTLALGLAATIAgadpLLNGFGIVGLTSLGTMISVLSLGIL 230
gi 503545499 178 SATTGPVNIPLNMAIALGLSKILEtsdpLLNGFGIIGLTSMGAVISVLALGIL 230
gi 504620350 178 SATTGPVNIPINMAIAIGLAKMLEnvdpLAYGFGIIGLTSTGAVISVLILGIL 230
gi 502959786 180 GVATGPMAVTFLMSMAIGVASSIDgrnpVIDGFGLVAMIALAPIIFVMILGVY 232
gi 502931106 182 GVATGPLANSFLLALALGASASMGdqdpIVHGFGFVALIALAPIISVMVLGLF 234
gi 498431945 183 GVATGPMCSTFILSMCVAIATQIEgrdpIIDGFGVVAMIALTPILSTLVLGYI 235
gi 505304717 427 GVATGPMSVAIIMSMYAAMAEVLGgeiaSENAFGVIALIALAPIIALSVLGIY 479
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap