Conserved Protein Domain Family
DUF1541

?
pfam07563: DUF1541 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF1541)
This family consists of several hypothetical bacterial and occurs as a tandem repeat.
Statistics
?
PSSM-Id: 311496
View PSSM: pfam07563
Aligned: 49 rows
Threshold Bit Score: 68.0966
Threshold Setting Gi: 81347316
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|...
2KY9_A         3 VGSQVIINTSHMKGMKGAEATVTGAYD-TTAYVVSYTPTNGGQRVDHHKWVIQ 54
gi 81741081   80 AGDEITITASHMPGMEGASGTIVGAYD-TTAYMVSYQPTDGGEMVEDHKWIIQ 131
gi 740763708  68 VGTEVLLTADHMAGMDGATATVSGAFD-TYTYSVSYTPTDGGEPVSDHKWVVQ 119
gi 501367823  92 VGTQVTLTTDHMEGMEGAPATVVGAYK-TVAYAVNYTPTDGGPEVTNHRWVVQ 143
gi 300533011  90 VGTEVILAADHMPGMDGAKATIVGAFDgTYTYAISYDPTDGGERVTNHKWVVQ 142
gi 503625989  63 TGSQVVIHADHMEGMNGAKATVKAAYA-TTVYAVNYKPVTGGAEVKNHKWVVQ 114
gi 504681454   6 VGDQVILKADHMPGMKGAKASIIAAKL-SNVYQITYTPTNGDSQVTHHKWIIQ 57
gi 226095298  59 iGSEVILKANHAPGMQGAKAKIVAAYD-TTAYSVTYTPTTGEPPVKNYKWIIQ 110
gi 528324823  83 VGAEVILTADHMPGMDGAEATISGAFD-TTAYSVSYTPTDGGEPITDHRWVVH 134
gi 348601706  89 VGDKVEVTDAHVDIMEGVTATITGAYD-TTLYQVTFTPEDSDEPMEDHKWVVa 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap