Conserved Protein Domain Family
Nucleopor_Nup85

?
pfam07575: Nucleopor_Nup85 
Click on image for an interactive view with Cn3D
Nup85 Nucleoporin
A family of nucleoporins conserved from yeast to human. THe nuclear pore complex is a large assembly composed of two essential complexes: the heptameric Nup84 complex and the heteromeric Nic96-containing complex. The Nup84 complex is composed of one copy each of Nup84, Nup85, Nup120, Nup133, Nup145C, Sec13, and Seh1. The structure of a complex of Nup85 and Seh1 was solved. The N-terminus of Nup85 is inserted and forms a three-stranded blade that completes the Seh1 6-bladed beta-propeller in trans. Following its N-terminal insertion blade, Nup85 forms a compact cuboid structure composed of 20 helices, with two distinct modules, referred to as crown and trunk.
Statistics
?
PSSM-Id: 311504
View PSSM: pfam07575
Aligned: 61 rows
Threshold Bit Score: 378.9
Threshold Setting Gi: 74965814
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D          30 KLYPVRIPRL-DTSKEFSAYVSGLFEIYRDLGDDRVFNvpTIGVVNSNFAKEHNATVNLAXEAILNELEVF--------- 99
gi 189240528    53 sVFQLRPDII-LFKPILRKLVNEANGTFLTLQAL--VA--TEG-DHKAELLKLSRQYRSIIRACLENLQDE--------- 117
gi 156395045     3 vLHEVQWQAD-AQSVIMRKLINETHGIFLDLQQLHE----TGVTLKKASLIKISRRYRAVLRSCLLQLRDT--------- 68
gi 242005779    68 vVHHVRSDSV-LFDPISRKLVNESNGYFIFAQKLLEKV--DST-DFSLEILKLSRQYRSVLRACLEDFQSA--------- 134
gi 321464098    13 KLYTISWERT-LYNPFVRKLVNESCGAFTSLQIKAG----TDGQISSSELIKSSHQYRCIMNACIEDLNQA--------- 78
gi 761906701    85 DLYEVQWSGIvLTTDSVRKLVSQSHAFFMELQEYAGKG--MDP----DVCVKYSRLYRVALYECTQGLNYEffflgenvd 158
gi 1031997396   50 TVHMLKPeVI-LFSPQLRKLVNESNGVFLSIKKLK-SF---SG-DIRLELLKHSKQYRSILRACIESLQDI--------- 114
gi 752866460    53 kVHFLRPeII-LFSPLLRKLVNESNGVFLSVQNLK-SF--SSG-DIRPELLKHSKQYRSILRACVENLQEI--------- 118
gi 156549624    57 KVHFLRPeVI-LFSPSLRKLVNESNGVFLSIQKVNCSP--TSN-DSRPEMLKYSKQYRSILRACIEELQDL--------- 123
gi 357625793    69 kILNIRQeVV-LFTPILRKLVNEANGTYLSVQKISETS--KTT-DNQVDFLKLSRQYRSIIRVCIESLQEA--------- 135
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D         100 IGR----V---------KDQDGRvnrfyeLEESLTVLNCLRTXYFILDgqdveenRSEFIESLLNWINRSDGE--PDEEY 164
gi 189240528   118 VMR----Adgdy-reelQNYITI------FYSVECIWHLCEILFVDAVp------GNIVLPHLLDWIRF---HfpKYDRN 177
gi 156395045    69 GLF----Irc------wNNELFT------LTMIELVWHLCEFLFIESVp------GGTVLTRLLEWSKt-----eRTERY 121
gi 242005779   135 SST----Sqgsk-kafyLQNIPT------FYNMELIWHLCEILFLDIIp------GDVVLSHLITWIRF---HvpQVEKE 194
gi 321464098    79 ADLansvEsnq----alQEMSEI------FYKAELVWNLCEILYLENPl------G--ILPHLLEWIR---IHfpNAVEE 137
gi 761906701   159 LEE----Nelq----diKGQLEM------YSLLNVLWHLCEILFIETLp------VGCLIQQLLEWVRWHDr--gDTDDV 216
gi 1031997396  115 CGKclsek-----reslENFLTI------FYQIECVWHLVEILYVDVIp------GDVVLPQLLEWIKF---HfpSRELI 174
gi 752866460   119 LPK----EplseektmlENFLTI------FYQVECVWHLTEILYVDAVp------GDVVLPQLLEWISF---HfpSRELI 179
gi 156549624   124 AEKcpqek-----knlyENFQTI------FYNIECVWHLTEILYVDVVp------GDVVLPQLLEWVRF---HfpSREIM 183
gi 357625793   136 ANR----EkeginkntyLSYLTI------FYSIECIWHLCEILYIDIIp------GEVVLPFLLEWVRF---HfpCHEQT 196
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D         165 IEQVFSVKdstAGKKVFETQYFWKLLNQLVLRGLLSQAIGCIERSDLLPYLSDtCAVSFDAVSDSIELLKQYPKD----- 239
gi 189240528   178 AASMLAG----DLGGLESHPDYWETVIGSLLQGRVKVVRALLKLHSEAESQPF---------RIVDQCLRAMPVYnmfsg 244
gi 156395045   122 LRDVLQ------YHPPSESPSYWPAVYSLVLQGQMKEACELLSQHPEKVHGSF------DVFEQIIDLMRTMPSYqmfmg 189
gi 242005779   195 ANKFLLEE---KAYSDFV-KQYWIVVIDCLLQRRIDTVRSLLKINPDFESEPF---------KIVDTILRTMPIFelygg 261
gi 321464098   138 TGTVLASP---N---PGLHESYWKALYGLVFQLRLESATKLLRIHPDFQSEAF---------QSAYELLKKMPVFsanst 202
gi 761906701   217 MNDVMSGV------RPDTHQDYWSIVYRLTLQGRIDDVRKLLTYSSY-------CKENKKVFDSIDELLRKVPMIksvig 283
gi 1031997396  175 AVKILAQK---TIGADLEYPNYWEVVIGCALHGKLDLVRALLALHSKADHPAF---------VMAENALKTMPVYnvygg 242
gi 752866460   180 ASKILSKK---TIGADLENSNYWEAVMGCAFHGKLNLVCRLLALHSKADHSAF---------ITADNIIRTMPVYnvygg 247
gi 156549624   184 AMKILAKK---KIGADLENNEYWEAVMGCALHGKLDIVRALLALHSKADHSAF---------IAAENSLRNMPVYnvygg 251
gi 357625793   197 AALLLESC---EVGSE-DHKDYWDTVIVMIVQGRVDVARALLKLHSAADSNEF---------KLIDNSLRSMPVYsvygg 263
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D         240 -----SSSTFREWKNLVLKLSQAFGSsaTDISGELRDYIEDFLLVIGGNQ---R---K---ILQYSRTWYESFCGFLLYY 305
gi 189240528   245 tsiaeFNLQWNHWVVDVQSKIDAKMF--I-----SCYNLNLIMKLTVGNE---IawgE---IQQYCETWYEMLAAWLFFT 311
gi 156395045   190 stasdFVSKWNHWHLEVKAQLEAETY-------AGHQELQLLCQVMAGDD---S---AfrqLKEFCPTWYQMLASKLLYC 256
gi 242005779   262 ltiseFQVRHECWKREAKRILIDGKF--S-----SHKYLTMIVKILIGDEtvqD---I---IMKHCETWYQHMVASLIYT 328
gi 321464098   203 vsapeFTFRWNHWKEECESRTQAGDF--FE-----SKDLELLLEILCGKE---EafeK---VGDHFETWYQRMITQLTFT 269
gi 761906701   284 hsrteLMGLWFVWNQECKRRRDRQDF--VGCPQLNLLCGLLCGDKSCFSR---P---E---VIDCCKMWYDMLVGRLLYT 352
gi 1031997396  243 ysineFTLCWKHWQLDLCSNLNSKAF-------VIDTNLEMIMKLIAGEQ---DilwQ---FSQYTDAWYELLAAKLFYT 309
gi 752866460   248 ysineFIIRWKHWQMDLCSNLETNYF-------VIDNNLEMLMKLIAGDE---SvlwE---YSMYTEAWYELLAAKLFYS 314
gi 156549624   252 ysvkeFTIRWKQWQMSLSQSIDSKAF-------GVEENLEALMRLVVGNEf-----wE---FSKYTEAWYELLAAKLFYS 316
gi 357625793   264 istgeFTISWKHWQAECRSKLNSK-L-------LQDPQLELVMRLMCGER---SafeC---VSVKFSSWFDLVGGWVLWT 329
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D         306 IPSLelS--A-EyLQXSLEAN-------VV---DIT-NDWEQPCVDIISGKIHSILPVXESL--DSCTAAFTAXICEAKG 369
gi 189240528   312 QPTV--K--SfE-LGQFAKQCit---kmSIg--NRI-KHLDRMLLAAMEFDILQVIKEIQNMtdSGWFVSHLTDLLYHSG 380
gi 156395045   257 NPAV--K--LyD-LQYHTQPCve---mfGG---NVAlGHFDRILLSAFEFDIYAVIKGSSESfgNWWFVSHLTDLLHHCG 325
gi 242005779   329 EPTV--K--IfD-LAFYANQSit---ryGG---PNCiKQLDLILCAIMEVDAFKVIERLQDWteKNWLPTHLTNLLYIGD 397
gi 321464098   270 QPTI--G--TlS-LGDEAEQFfas--liGL---DDL-TSLDATLLAVLRRDTRKVIGEMQGVldNSWFTAHLADLLYHAG 338
gi 761906701   353 SPLI--LstDyD-LHVIAKDClk---lyCDhkgTAP-YYFDTFILSALENKVIDVIKMVSSKlsNWWFVSHMTNLLHHRG 425
gi 1031997396  310 SPCC--K--QpE-LSHHANNIskrwqanRP---------SDNAIRALMESNLHLVIKEIQYMgdNGWFAAHLVDLLYICG 375
gi 752866460   315 APCC--K--QlE-LSRYANSVaerwqanRH---------LDRVILALIENDLYQVIKEIQYMsdNGWFAAHLMDLLYKCG 380
gi 156549624   317 APCC--K--QpE-LARHANSVaikwqsnRQ---TSL-MTLDNIILALMESDLHQVIKEIQYMndNGWFAAHLTDLLYHCG 387
gi 357625793   330 APWT--R--RgE-LSAAAAACaafth---------trgpLEQIVRALLDGDLHQVIREVQQIsdNNWFAAHLTDMLHHCG 395
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D         370 LI--------E-NIFE-GEknsddysnednexledL----F------SYRngxasYXLNSFAFELCSlgDKELWPVAIGL 429
gi 189240528   381 RL--------S-DTTI-ET----------------I----EnfhpdkLRE-----SFLIDYGSLLMG--HKSLWQVGLSY 423
gi 156395045   326 QL--------DsNQIS-CS----------------V----S------LRE-----FLLLEYSASLMS--HHSLWQVAVDY 363
gi 242005779   398 KL--------N-ISST-QS----------------SnfanS------LHE-----NLLLDYGTLLMS--HKSLWQAGVDY 438
gi 321464098   339 AL--------Q-SFEDiNS----------------L----Q------LRE-----TLLRDYSICLFS--HQSLWSVGVLY 376
gi 761906701   426 SL--------V-TSQL-EY----------------G----Sq-----LSE-----FLLIEYATALFV--HPSLWEVAISY 463
gi 1031997396  376 KLkildedqiE-V--S-NQ----------------------------LHE-----SLILEYGNTLMG--HHSLWQCGASY 416
gi 752866460   381 KLnilskektN-V--T-AQ----------------------------LHE-----SLILEYGTMLMS--HHSLWQCGASY 421
gi 156549624   388 RLnimdkhqiN-V--T-DL----------------------------LHE-----SLILDYGSTLMD--HHSLWQCGASY 428
gi 357625793   396 KLrildihqaD-V--T-SR----------------------------LRD-----SLILEYGSLLME--HKSLWSVGLSY 436
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D         430 IALSAtgtrSAKKXVIAELLPHYPFVTNDDIEWXLSICVEWRLPEIAKEIYTTLGNQXLSAH--NIIESIANFSRAGKYE 507
gi 189240528   424 LDHCP----SDGPEVTKLLLARLPLNSEMRAEKIVREALNRNLTETAQSICKVQGMACKNRG--RLGHALAWALKSQDGT 497
gi 156395045   364 LKHCP----QYGRAHLEEYIEHLPLETDKKAMKVLRVCKHLDLPYQAQSICKTMSMRALKMD--RLGSALSWCLRSKDSA 437
gi 242005779   439 LDYCR----VEGRATLETLLSRVPFKTNAKALKIIYIARERDLEEVVYNVSKVQGMRCLSRG--DIGGALTWAMKCQDPV 512
gi 321464098   377 LDHCP----NVGSATLEHLLTRLPCQSEMKATKIISLAERRKLTSVVTSVCRVMGRRALANR--RLGAAVAWAVKAQDAP 450
gi 761906701   464 LSYCP----TQGRHFMCSLVERVPLTTSTKALKLIRLCQRYEMTEEAQSICRVLARRCYGDG--RMGSALTWCIKGQDAT 537
gi 1031997396  417 LIHCP----TQGLARLEILLQSLPMGSEARVNKILDIARDNKMNHIVTSICKIQGLKSMKQG--RLGNALAWALKAQDNI 490
gi 752866460   422 LIHCP----KQGLGRLEILLQSLPTGTEARINKIIDVARDNNMPHVVTSICKIQGKKSIRQG--RLGNALMWALKAHDGN 495
gi 156549624   429 LEHCP----TQGLARLETLLQTIPLGSEARIHKIIDLANEKNMHNVVNSICKIQGIKCINQG--RLGNALAWALKARDIL 502
gi 357625793   437 LCGTP-----EGVRRAELMLERMPVQTEAKAMRITAEAKKYGLLGVVQSVSACMSTRHLSGGaeRTGGALAWGARARSGP 511
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4XMN_D         508 LVKSYSWLLFEASCXEGQKL----DDPVLNAIvsknspaeddviipqdildcvvtnSXRQTLAPYAVLSQFYELRDREDW 583
gi 189240528   498 FVSFLSNKFLREYAESGDLNsidlLDNLGSCI------------------------LASDRLMFLGKYYEFQKLYQANEY 553
gi 156395045   438 FAAFISERFLEEYCKNGDFTnldlIDHLGSDM------------------------LLNERLTFLGKYREFHRMYAEADF 493
gi 242005779   513 LSSQLADIYLKKYIKDGKFEsedlLQNLGSGI------------------------LLSDRLAFLGRYSEFCQMLKNGDQ 568
gi 321464098   451 LATYAADAVLKSYLQDSDFTstdlLDSLGAGL------------------------LASDRLAFLGKYREFHRLYNSNDF 506
gi 761906701   538 FAAFLAEKYFDFYESIGEFGdlsiLDYLGDAV------------------------LLSNRLAFLSKYRDFHKQYSFGNY 593
gi 1031997396  491 FITYIADQFLKRYVEYGKLDcrdlLENLGFCM------------------------MASDRLTFLGKYCEFHQMYGIGEF 546
gi 752866460   496 FTTYIADQFLKHYAEHGELEcrdlLENLGSCM------------------------LASDRLTFLGKYCEFHHMYGMGEF 551
gi 156549624   503 FTSHIADRFLKHYVEHAEIQcrdlLENLGPCM------------------------LVSDRLTFLGKYCEFHQMYGIGEF 558
gi 357625793   512 QCSRAAHAALRAHCAGRPLPaadlLLTAGPAL------------------------LVDDTLLLLGKYCDFHRLYKSREF 567
                          650       660       670       680       690
                   ....*....|....*....|....*....|....*....|....*....|....*
4XMN_D         584 GQALRLLLLLIEFPYLPKHYLVLLVAKFLYPIFLLDDKkLXDEDSVATVIEVIET 638
gi 189240528   554 KEAANLLVSLLESKIIPNFFWSILLTDAIPLLECEK-M-VFSSTDTYIIMQCLEE 606
gi 156395045   494 RGAATLLVSLLTSRLSPKSFWLTLLTDALPLLE-SNEI-IFTSNQTYELMHCLEE 546
gi 242005779   569 KEAGALLIYMLVNKVPPKFFWLTLLMDAVPLLE-KNKN-LFSSQDIYDLMSCLQE 621
gi 321464098   507 HSAAGLLISLISSRIAPKYFWTVLLMDALPLLE-TNPP-VFTSEQTYELMQSLQE 559
gi 761906701   594 EAAGQLLVSLLTSGITLKKYWLTLLTDSIPLLQIPDKC-VFSSADTYELLHILQE 647
gi 1031997396  547 KEAASLLVSLLVSNLTPKYFWSILLSDAIPLLE-AKDv-ILSSNDCYELLRCVEa 599
gi 752866460   552 REAASLLVSLLVSNLTPKYFWSILLTDAIPLLE-AEDv-IFSSNDCYELLRCAEa 604
gi 156549624   559 KEAARLLISLIVSELTPKYFWSMLLTDAIPLLE-TDDl-VFSSEDTFELLHAIEE 611
gi 357625793   568 KKAAKLLVSLITSNIAPEYFWSTLLLDTLPLLE-TEEp-VISSEDTYDIMLCLEL 620
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap