Conserved Protein Domain Family
LAB_N

?
pfam07578: LAB_N 
Lipid A Biosynthesis N-terminal domain
This family is found at the N-terminus of a group of Chlamydial Lipid A biosynthesis proteins. It is also found by itself in a family of proteins of unknown function.
Statistics
?
PSSM-Id: 311506
View PSSM: pfam07578
Aligned: 110 rows
Threshold Bit Score: 70.213
Threshold Setting Gi: 81547079
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81547079   28 IGYSGALLFGGRWVVQFLASKHAGRPVIPRLFWYMSVLGSLMTLSYFMFsaKQDSVGVLQNVLPAFTALY 97
gi 14285532  143 IGCIGLTIFSLRFFIQWFYLEYKNQSALPAPFWKASLLGGSICLLYFLR--TGDLVNVLCYGCGLFPSLA 210
gi 81626847  146 LGTISYLLFSSRFWVQWWLAEKSHSSELSTSFWWLSLSGAILSIVYFSH--IQDSVNLIGPLIGMVPYIR 213
gi 14285532   13 LGLFANLFFGTAFCVQWSLTRKKGYSVVPKIFWYLSGTGAVFMICHGFI--QSQYPIALLHSFNLIIYFR 80
gi 81626847   11 LGFLSSIAFGARFIVQWLQSEKQHRSVVTPFFWYLSLTGNTLLAIHSFI--QIQYHICLVQVCNGVISWR 78
gi 332170259 128 LGIVAQVLFTLRFVYQWFHAEKNKEATLPLGFWLFSFTGGLLSLLYFLY--RVDYVMVLSYGLGTFIYAR 195
gi 503690256 144 LGTIGLALFASRFWIQWWCAEKHKKSYLGPLFWWLSAVGECLSLVYFLR--IFDPVHFIGPAFGLIPAIR 211
gi 297375686 150 LGAFSGALFSSRFWVQWWQAEHRQRSELRSAFWWLSIAGSILSLIYFVG--IQDIVSVFNQSFGLIPYVR 217
gi 297375686  17 LGLAPAIFFGSRFIVQWIQSERLKQSTVTPLFWKLSLAGNLLFMLHYII--QVQYPFALIQAANGVISWR 84
gi 189187087  25 IGWIGNILFFSRFIIQWIATEKKKAVVVPLAFWYCSLLGSLLLLIYAFY--RWDSVFIFAYLFSWIPYSR 92
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap