Conserved Protein Domain Family
PSCyt2

?
pfam07583: PSCyt2 
Protein of unknown function (DUF1549)
A family of paralogues in the planctomyces.
Statistics
?
PSSM-Id: 311511
View PSSM: pfam07583
Aligned: 233 rows
Threshold Bit Score: 171.149
Threshold Setting Gi: 505062791
Created: 23-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123024719  140 IDRFVLARLEREGLKPGAEADRATLLRRLSFDLTGLPPATAEIDAFL----AdkspdAYEKQVDRLLALPQYGERMAMQW 215
gi 81661118   276 IDQLIEVKLDKLGITPSGLCDDSDFIRRASLDITGTLPAAADVRAFLadtrSd----KRERLIDELLDSPGYAAWWATRL 351
gi 503395311  374 IDESVFKKLKELGIPASAVADDATFLRRVFLDITGQTPSSAQVREFLaddsDd----KRQRVIEDLLASPEYASFFANKW 449
gi 503328252  282 IDALVVDKLRKLGIVPSGICDDAEFLRRVSLDLTGTLPIPEEVSSFLaddrPn----KRALKIEELLERPTYSAYWAMKL 357
gi 505062087  251 VDELVVNKLRKLGVVPAEVCSDSEFLRRVSIDMTGTLPTPAEVNAFLadawPk----KREQKVDELLSRPTYAAWWTNKL 326
gi 502677476  272 VDELVIQKLRKLGVVPSDLASDADFLRRVSLDLTGTLPTAGEVEAFLadssAd----KREKKINELLETPAYAAWWTTKL 347
gi 503394891  245 VDKLVVEKLRKLGVVPAEVCTDEEFLRRVMIDLTGTLPSPQQIREFVadrsSd----KRSAKIEELLQTPAYAAWWATRF 320
gi 918011012  242 VDRLVLEKLQKLGIEPAAICSDAEFLRRASLDIIGTLPTPSEVRTFLadkdEd----KRTRKIDELLAHPMHAAWWSVKL 317
gi 502877360  320 IDELVVQKLKKVGVVQSDLCGDEEFLRRVSLDITGTLPTPEEVETFVrskdVa----KRSKKIDELLERPAYAAWQATKI 395
gi 502677323  333 VDEHVMNKLSSLRIPVSPPCDDVTFLRRAMLDTIGTLPTPEEVLAFTadtdPs----KRQKLVDSLLNRPEFVDFWTLQL 408
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123024719  216 LDLARYADTHGYH--I---DSQ--R-DMWKWRDWVIDAFNHNMPFDRFGIEQL----------------------AG--- 262
gi 81661118   352 ADWTGNSDEQLNNal----pIR--GsASRLWYEWLRVRLEDNLPYDQIVEGIV----------------------MA--- 400
gi 503395311  450 SLLLRN------Q--K---DRPedQlGVYLFYDWIRNSLYENKPYDEFVREVL----------------------TA--- 493
gi 503328252  358 CDFTGNAERHFQG--T---INP--RlTAQHWYEWIERRLRENMPYDKIVEGIV----------------------LA--- 405
gi 505062087  327 CDITGNAPRALQM--Q---VNT--DePSRFWYEWIYRRVEQNMPYDQLIAGIV----------------------MAssr 377
gi 502677476  348 CDLTGNNDTKLNN--V---GVPg-MnPAQEWYDWLYKRVAENESYDKIVEGIV----------------------LA--- 396
gi 503394891  321 NDLIGLSVNQVNNvsF---NNN--R-TAEQWYEWVRYRFENNVPYDQIVEGIV----------------------LA--- 369
gi 918011012  318 AELTGGAPSQ--Q--S---DAP--QqFAQQWYDWLARRLAENMPYDQIVAGML----------------------LA--- 363
gi 502877360  396 CDYTGNNPEYLQN--AvvgNNS--AqAARDWYEWIHDRVQRNVPYDELAENIIlatsrregesyeqycervsgyyAK--- 468
gi 502677323  409 CDILQNRRERDHD--V----RG--TkGVRSLHAWVREQVAKNRPWNEM---------------------------AA--- 450
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123024719  263 ------------------DL------------------LPnaT----V-------------------------Q--QKLA 275
gi 81661118   401 ------------------Dn----------------------R----EedesylqycesmtqacrpgnesqfaE--RSGM 434
gi 503395311  494 ------------------SG----------------------S----I-------------------------D--QHPP 502
gi 503328252  406 ------------------RG------------------REp-G----E-------------------------SyaDYAA 419
gi 505062087  378 klgqsyedfikeessyfrEE------------------NPp-Ay---S-------------------------E--RDTM 408
gi 502677476  397 ------------------KSrkegqtyteyceemskyyHPd-SglkiA-------------------------E--RDEM 430
gi 503394891  370 -----------------------------------------------Q-------------------------S--QNDG 375
gi 918011012  364 ------------------ES------------------RPa-------------------------------------GA 370
gi 502877360  469 ------------------DS------------------KGs-F----A-------------------------E--QPAM 480
gi 502677323  451 ------------------DV------------------L---------------------------------------TA 455
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123024719  276 --SAF--NRNHM-----INyEGGAIPEEYQ--VEY-------------VADRVD---------------------TTSNV 310
gi 81661118   435 --PLY--WARRN-----FQ---------------K-------------PEERAI---------------------GFAYS 456
gi 503395311  503 --VAW--YR--------------------E--VTT-------------TDALVE---------------------DTAQL 522
gi 503328252  420 reSSY--YRPNPadqadFTeRDTMPYYWARrnART-------------PDDKAL---------------------SFSHA 463
gi 505062087  409 --PYF--WARRN--------------------MRQ-------------PEEKAL---------------------GFSYT 430
gi 502677476  431 --PYY--WSRNN-----IRq----------------------------PEEKAI---------------------GFAYT 452
gi 503394891  376 --ETYedYSARM-----SEmYNDASCEKFA--QQDslpyfwarrnfqkAEDRAI---------------------GFAYT 425
gi 918011012  371 --T--------------YRaYAEEMSSYFR--EAD-------------PADFASratlphfwsrkslqeprakalAVSHT 419
gi 502877360  481 --THY--WARRN-----FR---------------T-------------VEERAL---------------------GFAYT 502
gi 502677323  456 --KGD--VITTP-----QVgYYIVTVGEFR--RAE-------------ESEVVS---------------------SVAQG 490
                         330       340       350
                  ....*....|....*....|....*....|....*.
gi 123024719  311 FMGLTMGCARCHDHKFDPISQKDYYRFFAFFNTIAE 346
gi 81661118   457 FLGIRIECAQCHKHPFDQWSKDDFDQFAMLFKSIEA 492
gi 503395311  523 FLGVRIQCARCHHHPFEKWSQDDYYGMAAFFSRIgk 558
gi 503328252  464 FLGIRLECAQCHKHPFDQWTQADFQQFTQFFAGVRY 499
gi 505062087  431 FLGVRLECAQCHKHPFDQWTQDDFKQFTEFFRPIRY 466
gi 502677476  453 FLGIRIQCAQCHKHPFDQWSKNDFDAFKSFFTRVTY 488
gi 503394891  426 FLGTRIQCAQCHKHPFDRWTQEDFNEFQTVFSRTRY 461
gi 918011012  420 FLGIRLECAECHKHPHDQWTQQDFRELGKLLSAIEY 455
gi 502877360  503 FLGIRVQCAQCHKHPFDQWTKDDFDRFKNFFARIRY 538
gi 502677323  491 FLGTRVGCAKCHNHPLEKYTQDDYYHFAAFFGRVsf 526
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap