Conserved Protein Domain Family
DUF1569

?
pfam07606: DUF1569 
Protein of unknown function (DUF1569)
A family of hypothetical proteins identified in Rhodopirellula baltica.
Statistics
?
PSSM-Id: 311519
View PSSM: pfam07606
Aligned: 9 rows
Threshold Bit Score: 177.217
Threshold Setting Gi: 500152012
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122941007  29 GNDPEQLTITallAKLNQLTMLSTEQLAH--LshGEWNSAEVFAHCAQSVEFSMSGFPEHKSALFK--QTVGALAFTAFA 104
gi 123631655  30 ETNKFDLKIS---SALNKLELLSDKNLVQ--T--GKWELYKIFTHCAQSVEYSMSKFPEHKSSFFK--NTIGKLAFSLFS 100
gi 122499569   2 MN-------TaldTAFHRLDTLDLSAIQS--T--GDWDLGRTFSHLAQGVEFSMTGYPQEKPRLFQ--MTAGKLAFTVFK 68
gi 81657597    1 MEQLRELHFDdlnAAVREARSLLQSGYNR--N--GNWSLGQICRHLVLVQDPSVDGYPKWMS-LFAflRPVMRRILLPKV 75
gi 81659339    1 MSDLRSLQFEnldDAVLEAQSLLRTGYHP--Q--GNWSLGQICRHLTLVQNPSVDGYPAWMS-LFAflRPAMRRFLLPKL 75
gi 81658462   56 ATRRMDLRYPdlgAACTDIARLREGGYEL--V--GTWSLAQILDHLNLSMQMTIDGADFTFPALM---RPVMKWMFMPTM 128
gi 81659274   85 KISKRSLDFHsgdEVIAEIKRLQEGGYVQ--T--KNWNLTQICEHLDLIMTGGMEGFGFRMPRILR--ATVLKWIIGRIL 158
gi 500152012  32 capgrieRFAtwaEARNAVFALAQPGSRWrsN--GHWSLSQALQHLAQSVEGSLAGYPRLKPAWFT--HTVGAAAHAVFE 107
gi 500923275  32 AA-------VsleGALAVLGTLQGMTLRS--L--KGWSPSEVFNHCAQSIEYSMEGYPALKPAWFR--HSLGPAAFAVFS 98
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 122941007 105 TKGAMSH--NLAEPIPAAPKLDRNLDVNLALARLIQSLTDFQQYQAELAPH-FAYGELNKADYELAHVLHFYNHQQSFTK 181
gi 123631655 101 SKGKMTH--SLSEPIPGSPLIDSTLDTTEALNHLKKSLTDFDNYKGELAPH-FAYGELTKSDYEIAHVMHLYNHLQEVKS 177
gi 122499569  69 LRGRMSH--GLDEPIPGEVIGEVSADD--GLHRLWSSLEQFRDFNGALQPH-FAFGALGKDQFAMAHLMHIENHLEEVRP 143
gi 81657597   76 LSGDS----PRGIRTASMFVPPADLDDAREVEAFSASVTRFYAHLGDYAPH-PAFGRLPRERIEQIHSAHAAHHLRFLAP 150
gi 81659339   76 RRPDS----PRGIRTSSMFVPPEDIDDAEEVDTFARSVDRFRAHSGEYAPH-PAFGRMSRSEIEEIHTWHAAHHLRFLTP 150
gi 81658462  129 RKGKPS---KLRGKAPEQLQPAMDLDEDACAKRFYSLAETLMDPSTPFVSHyPMLGRLTREQWLLMQQWHAAHHLSFVVP 205
gi 81659274  159 RQRKMSSapTLDRLKPKS---PDGPDDPSVIDHCIETIHRAKAFDGSMEDY-PFVDNMTPDMWRQFMWLHAAHHLGFLVP 234
gi 500152012 108 ARGRMTH--PLDEPLPGAAPLDAALPPDAAALRLLRAMDAFEAHDGTLAPH-FAYGVLDKPAYARAHQMHLAAHWQQFEE 184
gi 500923275  99 ARGAMRH--PLDEAIPGAAPLLEPASQAQALERLQVAFERFAAYGGELQPH-FAYGALDHGEYAQAHVLHLYNHLSLIRP 175

                 .
gi 122941007 182 M 182
gi 123631655 178 I 178
gi 122499569 144 T 144
gi 81657597  151 R 151
gi 81659339  151 N 151
gi 81658462  206 N 206
gi 81659274  235 K 235
gi 500152012 185 T 185
gi 500923275 176 A 176
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap