Conserved Protein Domain Family
DUF1572

?
pfam07609: DUF1572 
Protein of unknown function (DUF1572)
These proteins, from several diverse bacteria, share a short conserved sequence towards their N termini.
Statistics
?
PSSM-Id: 311521
View PSSM: pfam07609
Aligned: 11 rows
Threshold Bit Score: 264.59
Threshold Setting Gi: 81550974
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81550974    4 VAALYLSELRERLRGTRQLGDRALAQLPDDAWHTVLAPGGNSAAVIVQHLAGNLRSRWGGLQSgyregVEGETPGRDRDA 83
gi 81582534    3 IGREYVQCAISNFEATKKQGERVLSQLSYEQIEWSSHEETNSIAIIIKHLHGNMRSRWTDFLT-----SDGEKINRNRDA 77
gi 81347953    3 IGQEYLRVVRARFVDMKKTAERAMDQCSEEQLFHCFHEEANSIAIIVKHMSGNMVSRWTDFLS-----SDGEKPDRNRDD 77
gi 122252280  31 FTTSYLADALTLFRYYKKMGEAAIAQVTDEELTKALDGEMNSIAVIVKHMTGNMRSRWTDFLT-----TDGEKPDRDRDS 105
gi 81662767    3 ESTPWLNAMRDTVVSYRRMIDGSVAQLTDAELHMRPENGANSVAIILRHLGGNLRSRWTDFLT-----TDGEKPDRNRDA 77
gi 81741256    3 FGNEYLKVVRERFKSVKDLGDKTINQLSEEDIRWILNEESNSVAVIVKHLSGNMVSRWSDFLT-----SDGEKSYRNRDQ 77
gi 499844765   5 FSTSYLKDSIALFRYYKQLGDRAIAQVSDEHLASTLDPEMNSIALIVKHLAGNMRSRWTDFLT-----TDGEKPDRNRDS 79
gi 503072740   3 FARNYLDSAIFEFRRYKTMGDKTFAQLGNDEILWTSSHTDNSISQIVKHISGNMLSRWTNFLT-----EDGEKPWRHRDT 77
gi 501338755   3 FEEVYLTAIQARFRAVREPAEQALGWLNEEQFHQTLAPDTNSVALLIQHMTNNMTSRWTDFLT-----TDGEKPDRNRDA 77
gi 500641575   3 T--DYLESAKKQFEYYKMLGDKTIDQLPDDKLFWQYNDESNSIAIIVKHLSGNMLSRWTDFLT-----SDGEKEWRHRDT 75
gi 500933981   3 TDESYLESVKKQFLYYKMLGEKAMDQLEPEQLFTAINEDTNSITAIVKHISGNMLSRWTDFLT-----SDGEKEWRNRDA 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81550974   84 EFEDAHLSAADLLTCWDEGWQVFLDALDHLRPDDLTQTLTIRGEAHTVLGAVERAALHASGHVFQLIFLVKTLRGADFQT 163
gi 81582534   78 EFEGGYSSKEEVLAAWNEGWEYVFKTMNVLTPEHLIQTVYIRGEAHTVIQAIERQISHYALHIGQMIYIGKMLKENEWEC 157
gi 81347953   78 EFINDFHTRKEVLACWEKGWSAFFQTLNELQETDLLRTVTIRGEPHSVIEAIERQMYHYSYHIGQIVYIAKQLNANNWKT 157
gi 122252280 106 EFVEPPPTRAELMKAWEEGWDHLWRALGQLQEHDMVRTVTIRGERHSVMQAINRQLAHYPYHIGQIVMLAKHFRGDKWQT 185
gi 81662767   78 EFVDWTGDRQSLIEHFDRGWSALVSAIDSIDAENIGQTIFVRGEAHTVAQALTRSLTHVTYHVGQIVLVARLVHEGEWRW 157
gi 81741256   78 EFENNISSKQELIAIWEKGWNILFNTLSDLGEQDLLKNIYIRSESHTVVDAIERQMAHYAYHVGQIVYIGKQLKDKDWKS 157
gi 499844765  80 EFEAAPQTRKEITAMWEQGWALVFGALEPLTDADLTRTVTIRHEPHSVMQAINRQIAHYSYHVGQIVFLAKHFQSDQWKS 159
gi 503072740  78 EFEIPFTTKIEMIKAWEKGWQCLFDALDTLNDDNFDTKIKIRNEAHTIPEATNRQLAHYASHVGQLVLLGKMIKGENWIS 157
gi 501338755  78 EFVDQGHDKETLLTLWNDGWKLVESTLVSLTPDDLERTVLIRGEPHLVVDAIERQLAHYAYHTGQLIFLMKILLGPDFKP 157
gi 500641575  76 EFDNDIKTKAELIQKWNDGWNCLFNALNSLQEEDFSKTIYIRNQGHSVTEAINRQLAHYPYHIGQMVFIGKMICNDKWIS 155
gi 500933981  78 EFENDLHSKEEVLEIWNKGWNCLENALESLKPEQLSDIIYIRNEGHTVIEAINRQLAHYPYHVGQIVFYAKQLKKSSWES 157

                 ....*..
gi 81550974  164 ISIPRGG 170
gi 81582534  158 LSIPRGK 164
gi 81347953  158 LTIPRNR 164
gi 122252280 186 LSVPKNR 192
gi 81662767  158 LTIAPGL 164
gi 81741256  158 LSIPKGK 164
gi 499844765 160 LSVPRNR 166
gi 503072740 158 LSIPKGE 164
gi 501338755 158 LTIPLPH 164
gi 500641575 156 LSIPRGN 162
gi 500933981 158 LSIPKNK 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap