Conserved Protein Domain Family
DUF1577

?
pfam07614: DUF1577 
Protein of unknown function (DUF1577)
A family of hypothetical proteins in Leptospira interrogans.
Statistics
?
PSSM-Id: 311525
View PSSM: pfam07614
Aligned: 8 rows
Threshold Bit Score: 233.84
Threshold Setting Gi: 81472465
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81470973   30 NLVKHLFYYLKADEVEFPFD-YDGQRFFAVVENIEETTVNLRISGATQGLTLRAKISFEIMNILYQFEVIILEFMEDSIV 108
gi 81471535   19 QKDHVITKYLLDKELVFKID-PFDRKAVIKKVLEEGEKIIIQVSKEEDLPKENSFILYTILAKYIQLECILLQKLENSLF 97
gi 81470546   21 QRKHIIEKHLLNQSLRIKGD-LNRETITIQRYVDSGEKIIAGISDETHFSENDEIVLYKILAKYVQLECSFIRKTRPGVA 99
gi 81472465   23 KIKYILKEYIHFQGLLVKES-PFHQELKPMEIREDGTFIFPIDSTLTNI--NDELVLYRTLSKHIEISFDVIEKT-DTQI 98
gi 81469070   19 KKFHIISKFLVQTDIIAQTSnSLKQIVKILQVSKDATKILVQTQTPNALPLNSHVTLAKLLAKYVELSCEVIDEKPNNQF 98
gi 501356697  19 KKLHVLTKFLLNQELNLKDDiHSGESCYLKKVSQDGNKILVSVRPTITLSVGQKITLYKILGRYLHLECTVEQEKGESQY 98
gi 501356311  30 NIVKHLFYYLKADNREFEFI-YEEDNLVAAVEEIEAHSVTLMIPDLVEKGSRRARVRFEVMNINYQFEVVILD-IQKEQI 107
gi 501358095  12 QKNHVILHYLMNQEMKASWN-GQVQTMTVLQEVPGGEEIILQWSEIWPIGEGSTIVLSKLLARYLELHCVFVKQLAPHKI 90
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81470973  109 QIRIPSELQAASFRKNVRVAVDDLFMnYVILFRSlsgggreiGRNIQVEQRFNSLmreikkdnpdlRLINIIISEYISNI 188
gi 81471535   98 IIKVEKLAIARKNRETQRFQVESDTM-YVTNVVS--------SKTVIEANMFNIP-----------TLVKVNFEDFKNRL 157
gi 81470546  100 EFSVNKVSIAKSNRAFPRYSVAEDAA-HVTNINS--------SKTVIDASLFNIP-----------TLVKVSFEDYKTKL 159
gi 81472465   99 ICKPLFARIAKAKRMSPRI---EGLM----------------GKVI--AHKFLIPrkeldiakvlgTSGQIILNDLNRKV 157
gi 81469070   99 ILSVSEISIASKERSLNRIVPPEGTV-WITNIRT--------SKTTIDANLFNIP-----------TSVKVNFADYETKL 158
gi 501356697  99 VLQLNKIAIAKKDRESSRIPVPPGSA-WITNVVS--------SKAKIETDMFHVP-----------TAVKVNFQDFETKL 158
gi 501356311 108 VIKTPTELQSYQLRTNKRIPVDDLFMnFIILFRSlsggsrevGKNLYAESRFPHLmkevrkdrpdsKLINIMLTEAIERI 187
gi 501358095  91 QLRVEKVLIAKKERLNPRFSITEEGMvNVTNIVS--------SKTIIEANMFNIP-----------TLVRVNFEDYRKRM 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81470973  189 SREY----EIVFFSQHREETflD-SFVRR----HDRPVFIPDTSLIINYIREDdgsesiggnyrEEYMRMVLENg-QDYA 258
gi 81471535  158 KQKTndtvNIDTFGPGLNHK--F-EIVKK----TLKYLLLENTQDPNSYKNNS-----------PGRIHYEKEI--DDDL 217
gi 81470546  160 KPDQlglvEIDVFRSDQDEK--F-ELIKR----TKKYIHIENTSLEESYKSKS-----------ENQVDVEDEI--HEEI 219
gi 81472465  158 KQIYp--sSKLVFNSSKELSpeE-ELVKK----YKKPIYIRDTSTLDSNPEGEfa--------nLDLLPIKETLqeELIL 222
gi 81469070  159 KSKYdf-lKVDVFGTIGDK---F-DLVKK----TRKILYISNTQKEQSYAAYNq----------EDFIDYAAELgdEEDV 219
gi 501356697 159 KNSVdf-iKISTFNSREDNEv-I-RQIKK----TKKGLLLEDVNNKECYVTSPn----------EDFLVFADEI--EEDI 219
gi 501356311 188 SKDY----EIHFFKEDEKLNe-FdDFIKKtilqTSKTIYISDCNRITSYINEPndevl--fnyfSEHKEMAKELg-DEFA 259
gi 501358095 152 MVRSgeagTMDIFKSGMERK--F-DVVKS----SQKILFIKDATSPESYKMDA-----------EGFLNYEDDI--EDNV 211
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 81470973  259 DNFFRELQKKEIRefviSYIVLPIRLFND------VVGYIRVYTSAMdrfSITPFQVGYLIEL 315
gi 81471535  218 DSCIQEYKDQQII----SELIVPIVYINHsee-qiPIGYFSIQSKEQ---SFTEKDIQEFQTL 272
gi 81470546  220 PSLMRKYKDEKIV----SEIIYPIIYINHsrq-siPLGYIWVRNKEK---TLGNNTIEKLAEL 274
gi 81472465  223 EERLRFFKSSKTR----SLLIYPILFKSGgetqifAMGVI--ESSEG---PISDQVVPLYKEM 276
gi 81469070  220 HKRIIEYANQKIK----SELIVPVIYLSHeeq-aiPIGFVHAQNRSR---EIDILEVMEIKTL 274
gi 501356697 220 AKEINNRRNLKIK----SELILPILYLNDeee-siPIGYIHMQSKSE---NFDLLKAMEMKTL 274
gi 501356311 260 LEFFESMRKHESRnfyvSYIITPIRLYED------VVGYIKVFSTAMerfTISQNQAVYIFEL 316
gi 501358095 212 DKLAFAARDKKIK----SELILPILYKNElee-iiPIGYYWLQTKDK---LISDDD---LKFY 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap