Conserved Protein Domain Family
DUF1579

?
pfam07617: DUF1579 
Protein of unknown function (DUF1579)
A family of paralogous hypothetical proteins identified in Rhodopirellula baltica that also has members in Gloeobacter violaceus, Sinorhizobium meliloti and Agrobacterium tumefaciens.
Statistics
?
PSSM-Id: 311526
View PSSM: pfam07617
Aligned: 47 rows
Threshold Bit Score: 118.128
Threshold Setting Gi: 81779000
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123512629   6 EVLKEHSFLERLVGDWS-----VTAPEMSDGKDw-TETVRSL-HGIWFVAEGTGPMPNgKQASTILTLGYNAEKGKYVGS 78
gi 504491551  38 TPGDIHKMMAKDVGKWKaevtsWMAPDAPPTKStaECVDKMIlGGRYLHQTFTGNFMG-QPFEGIGTIGYDNAKKMFVSS 116
gi 752618098  25 klTAPHKMLASLAGSWTtkttaWMGPDQPAMEStgTCEQKMLlGGRYLQQEYTGEMMG-DTFTGINLIGYDNHTKKYVST 103
gi 501818403  24 TPGAPHRLLARMEGSWDariksWMEPDQPPVESvgICEQKMVlDGRFLQQEFRGKMME-SPFNGIGFMGYDNNSKKFVST 102
gi 504668508  35 TPGPMHEMLSKMAGDWKtvmtmKGQGGQE-MKSegTAKFEMImGGRYLKSTFKSDMMG-IPMEGMGIDAYDNAKKEFISV 112
gi 504373973  39 TPGSMHEMMAKQVGEWKmvskmWMEPNAEPVVSegTVNAEMIlGGRYLKMVAKFPMMG-MQTEGWSLEAYDNGKKEFINI 117
gi 390625824  31 KLTAPHKMLASLAGSWTtkttaWMGPDQPAMEStgTCEQKMLlGGRYLQQEYTGEMMG-DTFTGINLIGYDNHTKKYVST 109
gi 300606830  45 QPGAPHKAFAGLAGSWTtttkeWMEPGKPPTEAsgTAEMKMLlDGRFLYQEFKSQMMG-QPFSGIGIDAYDNVRKKYVTA 123
gi 500931303  60 TPGNPHKMMADEVGTWNcdmtfWSEPNGKSEKAasIAVVRMIlGGRYQEADYKGTMMG-QPFEGKSTLAYNNASQEYTTT 138
gi 156603336   5 TPTEAHASLAKENGIWDeeltiWMHAGATPETTkaTAEYKMIlNGMHQEMTHKGDFMG-MPFEGKGTMSFDNASQEYIST 83
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 123512629  79 WIGSMMDYMWVYEGEVDASGNVLDLYTTGPDFSGDGFADYRERITFVDDNHRTFTSSAKQEDGSWKQFMEAHYIR 153
gi 504491551 117 WVDNFGTGMMYMEGPWDDATKSITFKGKCVDPMSGNDMECRQVMKFIDDKTQMMEMYMTQ-GGKEMKTMEITFTK 190
gi 752618098 104 WIDSMSTGIYYFEGTASEDGKIITQESSLDDPVRGPIV-WRSVTTIVDENNMKYEMYITPKGGTEEKVMVMTVTR 177
gi 501818403 103 WMDTMGTGIYLFEGDLGEDERSIIQTSSYNDPIQG-PMNWRSVTRVVDNDTWAMQMFSTGTGGKEMKMMEGVYSR 176
gi 504668508 113 WIDNMGTGVTVLKGNLDQDTKTLTYYGTTVDPASGEDSKIKSVTKIIDENNHKFEMYSVMPDGSEVLMFEMDYTR 187
gi 504373973 118 WIDNMGTGVAISTGKFDDATKSIIYNGKMYDPVAGKDVEFKSISKMVTDNQMVFEMFGNF-DGKEVKMMEINYTR 191
gi 390625824 110 WIDSMSTGIYYFEGTASEDGKIITQESSLDDPVr-GPIVWRSVTTIVDENNMKYEMYITPKGGTEEKVMVMTVTR 183
gi 300606830 124 WMDTMGTGIFIMEGTASADGKTITLKGSHPEPGg-GQMHHRAVWKLPDNNTQTFEMYGNHGHGKEEKMMEITYIR 197
gi 500931303 139 FIDNMGTGMMVAMGKYDEKTKSMELKGEMVNPLNgKKTPYREVYTIVDPTTRKMEMFDTK-NGTEYKSMEIIMKK 212
gi 156603336  84 WIDNMSSGVTTMRGKLDKSTNILKMEGEVIDPVTkRLKTMREVMTYIDNDNHKLEMFDTGYDGVEYKTMEIVLKR 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap