Conserved Protein Domain Family
DUF1590

?
pfam07629: DUF1590 
Protein of unknown function (DUF1590)
These hypothetical proteins in Rhodopirellula baltica have a conserved C terminal region.
Statistics
?
PSSM-Id: 116246
View PSSM: pfam07629
Aligned: 2 rows
Threshold Bit Score: 59.7527
Threshold Setting Gi: 81663156
Created: 22-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30
                ....*....|....*....|....*....|..
gi 81663156   1 MGSGAHYPPPEISLNALFPTPPAARAGFSRLY 32
gi 81659539 170 MENGADCPPPEISLNARFPTPPAAQARFSRVL 201
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap