Conserved Protein Domain Family
ANTH

?
pfam07651: ANTH 
Click on image for an interactive view with Cn3D
ANTH domain
AP180 is an endocytotic accessory proteins that has been implicated in the formation of clathrin-coated pits. The domain is involved in phosphatidylinositol 4,5-bisphosphate binding and is a universal adaptor for nucleation of clathrin coats.
Statistics
?
PSSM-Id: 311541
View PSSM: pfam07651
Aligned: 28 rows
Threshold Bit Score: 242.601
Threshold Setting Gi: 46396002
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HX8_A         23 GLAKSVCKATTEeCIGPKKKHLDYLVHCANEPnVSIPHLANLLIERSQNA-NWVVVYKSLITTHHLMAYGNERFMQYLAS 101
gi 74590078     7 DLQTSVKKACNA-DEVPPKRKHVRACIVYTWD-HKNSRAFWNAVKIQPLQsNEVQLFKALIMIHKVLQEGHPNTLKDGYR 84
gi 384872634   16 SLMTSVRKATSI-DETAPKRKHVRSCIIFTWD-HHTARPFWTAIKVQPLLaNEVQTFKALITIHRVLQEGHKSALVDSQS 93
gi 74618053    15 ELAINIRKATSA-EESAPKRKHVRSCIVYTWD-HKSSQSFWAGMKVQPIMaDEVQTFKALITIHKVLQEGHPATLREAMA 92
gi 74604589     9 DLNVNIKKATNT-DESAPKRKHVRACIVYTHD-HRSSKAFWNGIRIQPLQtDDVMVFKALITIHKVLQEGHPSALRDAQA 86
gi 206729937   39 TQTVSINKAINT-QEVAVKEKHARTCILGTHH-EKGAQTFWSVVNRLPLSsNAVLCWKFCHVFHKLLRDGHPNVLKDSLR 116
gi 13431563    30 TQAISISKAINT-QEAPVKEKHARRIILGTHH-EKGAFTFWSYAIGLPLPsSSILSWKFCHVLHKVLRDGHPNVLHDCQR 107
gi 74960188     9 GQFQAVQKAITK-DETPLKPKHLETILLGTHT-EKSSAIFWSSVKKIKLEnHPVLTWKFCLLVHKLLRDGHPVVPKEAYR 86
gi 74865864    11 HLNVSVSKALNG-LEAPLKTKHARSIIIMIHK-AKEAKTFWMIISRQPLMqSRFTAWKFSHLLHKVLREGHESAIRHSQS 88
gi 207341898    7 DLQKALKKACSV-EETAPKRKHVRACIVYTWD-HQSSKAVFTTLKTLPLAnDEVQLFKMLIVLHKIIQEGHPSALAEAIR 84
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HX8_A        102 SNSTFNLSSFLDKgtvqdgGMgvpggRMGYDMSPFIRRYAKYLNEKSLSYRAMAFD----FCKVKRGk-----EEGSLR- 171
gi 74590078    85 NRDFIASLATVFP-------------SHGSAYGRLINQYDKYILQKLDFHRNNPGFng-tFEYEEYIslr-avNDPNEGy 149
gi 384872634   94 EKGWLKTCERqy------dGE-----SSPKGYSDLIRDYVDYLLDKLSFHAQHPEFng-tFEYKEYIslr-qvDDPNEGy 160
gi 74618053    93 NRGWIDSLNRGMG-------G-----EGMRGYGPLIKEYVYYLLAKLSFHQQHPEFng-tFEYEEYIslk-aiNDPNEGy 158
gi 74604589    87 NVNFIQSLARGNNyt---gPN-----QGNHGYGKLISEYVRFLMQKLTFHKYHPAFng-mFEYEDYIslr-tvNDPNEGy 156
gi 206729937  117 YRNELSDMSRMWG-------------HLSEGYGQLCSIYLKLLRTKMEYHTKNPRFpg-nLQMSDRQlde-agESDVNNf 181
gi 13431563   108 YRSNIREIGDLWG-------------HLHDRYGQLVNVYTKLLLTKISFHLKHPQFpa-gLEVTDEVlekaagTDVNNIf 173
gi 74960188    87 NEKRFTQLALHWK--------------DKRDYGPCIDAYCKLLHDRVIFHHKRPYFpg-nLFVSPLQldt-mgRDLSRMl 150
gi 74865864    89 HKKMILEVGKMWG-------------LLQDDIGCCIQAYSKLLATKLNFHDKNRMFpg-tLNISFTElfi-avDRDLnyc 153
gi 207341898   85 DRDWIRSLGRVHSg-----GS-----S----YSKLIREYVRYLVLKLDFHAHHRGFnngtFEYEEYVslv-svSDPDEGy 149
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1HX8_A        172 ---S--MNAEKLLKTLPVLQAQLDALLEFDCQSNDLS--NGVINMSFMLLFRDLIRLFACYNDGIINLLEKYFDMnkKHA 244
gi 74590078   150 e-aL--LNLMDLQDSINDLQKLIFATIN-----QSHS--NLCKVSALVPLIAESYGIYKFCISMLRAMYQQLGED----- 214
gi 384872634  161 e-tV--YDMMNLQDHIDEFQKQLFSNFK-----RSNK--NECRIAALVPLVQESYGIYRFLTSMLRALYSTVDAP----- 225
gi 74618053   159 e-tI--TDLMTLQDKIDQFQKLIFSHFR---NVGNN----ECRISALVPLVTESYGIYKFITSMLRAMHSSTGD-----A 223
gi 74604589   157 e-aI--MNLMTLQDGVDDFQRLVFSSLQ-----RSRS--NECKISSLVPMIAESYGIYRFVISMLRAMHVSTGN-----D 221
gi 206729937  182 fqlT--VEMFDYLECELNLFQTVFNSLDMSRSVSVTAa-GQCRLAPLIQVILDCSHLYDYTVKLLFKLHSCLPA------ 252
gi 13431563   174 q-lT--VEMFDYMDCELKLSESVFRQLNTAIAVSQMSs-GQCRLAPLIQVIQDCSHLYHYTVKLLFKLHSCLPA------ 243
gi 74960188   151 r-lT--GDMMHQMDSLLAFQEKVYLLSNSSPRWDPNTpqGQCLMLPLISVIMDTWPFFIYIVRMMYNLHSNVSP------ 221
gi 74865864   154 fqlC--VEIFDYLEDIIALQLTIFSSME-KYRMSSMTpqGQCRLAPIVCLIQDSNALYDLSVRLMFKLHDGVPY------ 224
gi 207341898  150 ---EtiLDLMSLQDSLDEFSQIIFASIQ----SERRN--TECKISALIPLIAESYGIYKFITSMLRAMHRQLNDA--EGD 218
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|....*.
1HX8_A        245 RDALDLYKKFLVRMDRVGEFLKVAENVGIDKGD--IPDLTKAPSSLLDALEQHLAT 298
gi 74590078   215 DALSGLVERFDSQHFMLRDFYTDCHAIKFLTSLitIPRLPNSAPNLKVTDDGqpis 270
gi 384872634  226 ETLEPLKHRYKSQHHRLRQFYADCSNLRYLTSLisVPRLPHDPPD-LEGDDNIPDL 280
gi 74618053   224 EALEPLRGRYDAQHYRLVKFYYECSNLRYLTSLitIPKLPQDPPNLLAEDENAPAL 279
gi 74604589   222 EALESLRQRFYSQHDRLRDFYYDCSTLKYLRSIvtIPQLGKNPPNLLEEEDgpglp 277
gi 206729937  253 DTLQGHRDRFMEQFTKLKDLFYRSSNLQYFKRLiqIPQLPENPPNFLRASALSEHI 308
gi 13431563   244 DTLQGHRDRFHEQFHSLRNFFRRASDMLYFKRLiqIPRLPEGPPNFLRASALAEHI 299
gi 74960188   222 HELEGYRSRFQTIFEKTKQFYEECSKHQYFRCFvqIPTFPLHAPNFFTQSDLESYQ 277
gi 74865864   225 DVVSGHRDRFHGLFLKLKSFYNNVRPLQYFKDLitIPELPDSSPNFKSQNDFTSYV 280
gi 207341898  219 AALQPLKERYELQHARLFEFYADCSSVKYLTTLvtIPKLPVDAPDVFLINDVDESk 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap