Conserved Protein Domain Family
SOR

?
pfam07682: SOR 
Click on image for an interactive view with Cn3D
Sulphur oxygenase reductase
The sulphur oxygenase/reductase (SOR) of the thermo-acidophilic archaeon Acidianus ambivalens is an unusual enzyme consisting of 24 identical subunits arranged in a perfectly symmetrical hollow sphere and containing a mononuclear non-heme iron centre (personal communication: A. Kletzin). At 85 degrees C in vitro, elemental sulphur is oxidised to sulphite, thiosulphate and hydrogen sulphide with no external cofactors needed. The proposed equation is: 4S + O2 + 4 H2O ---> 2 HSO3- + 2 H2S + 2 H+.
Statistics
?
PSSM-Id: 311557
View PSSM: pfam07682
Aligned: 10 rows
Threshold Bit Score: 434.523
Threshold Setting Gi: 505070884
Created: 26-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CB2_A         3 KPYVAINMAELKNEPKTFEMFASVGPKVXMVTARHPGFVGFQNHIQIGILPFGNRYGGAKMDMTKeS------------- 69
gi 74567748    3 KPYVAINIVEMLNNETTMNMFQQVGPKVCMVTARHPGFVGFQNHVQFGVIPLGTRYGGASMDMTK-M------------- 68
gi 74574131    3 KPYVAINMVEVRNDPKTLELFGKVGPKVCMVTARHPGFVGFQNHVQIGVVPLGTRWGGAKMEMSQeM------------- 69
gi 505072368   8 GAALAINQAAVANDPQTFEKMGHIGPKVCLTTANEPGFLGFHAFLQTGTHPLGGRFGAAQVVTADsLeavies-phnlrl 86
gi 850914694   3 kpyvainMAELKNEPKTFEMFASVGPKVCMVTARHPGFVGFQNHIQIGILPFGNRYGGAKMDMTKeS------------- 69
gi 339284496   3 VPYIAVNKARVLNAPSSFETFTSVGPKVCMVTANHEGFVGFQNHVQVGVFPMGGRYGAAKMDMHEeL------------- 69
gi 505070884  24 pLYVAINRVLVENNPNLMRMMRQASSEMCLATALTPGFRGFDLMRQTGSCPMGMRWG-ASTDMTQeL------------- 89
gi 256578139  10 pIYVALNMSKVVNNEESFDLMHKVGPRVCITTATHPGFLGFMANIQTGILPLAGRYGGGSTHMENaL------------- 76
gi 502586333   5 NPIIAINMAKIANKPDSYETMMKVGPKVCITTASHPGFLGFEQLLQTGIHPMAGRYGGGAVDMREtL------------- 71
gi 81343400    8 GVAVAINKAKVNNTPRFQELMYQVGPKVCITTAMHEGFLGFHAFIQVGAHPLGGRFGAAKVINADsLeaiqregltaiky 87
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CB2_A        70 STVRVLQYTFWKDWKDHEEMHRQNWSYLFRLCYSCASQMIWGPWEPIYEIIYANMPINTEMTDFTAVVGKKFAEGKPL-- 147
gi 74567748   69 STMNVYQYTMWKNIKDHEDMHRENFSSIFRLCSSCLSQVVYGPWEPLFEIVDADMPLNTDMMDFTVMFGKKFAAGDPS-- 146
gi 74574131   70 HSLMLMQYTFWKNWKDHEEMHKQNWANLFRLCLQCADQMIWGPYEPLYEIVYANMPLNTEMTDFTVMVGKKFAAGEAV-- 147
gi 505072368  87 NPLNLWQYTLWEDAESHERMHYEQYDRIFELCAGCLDMVVDGPWEPVYTIAEANMPPIIGMTDVPRVMGQAFARQQEP-- 164
gi 850914694  70 SSVRVLQYTFWKDWKDHEEMHRQNWSYLFRLCYSCASQMIWGPWEPIYEIIYANMPINTEMTDFTAVVGKKFAEGKPL-- 147
gi 339284496  70 NPIGIVQYTMWRHWEDHEAMHYENFDSIFRLCSQCLNMVVEGPWEPLYEIVAHDLPENVSMTDVPAALGAAWMAGQPV-- 147
gi 505070884  90 SHIWIDQFTYWDTLDAHEEFHETFEDVVVTACDKCGNVLLDGPEEPVYRIVASHLPRLVSLNQ--------FEQARAQer 161
gi 256578139  77 NPVRNYQYTMWKHWKDHDEFHEKQFSRIFELCTSCLEMVVEGPWEPVYSVIHAKMPTVRSMGQIAD-LGKDFVQQKDF-- 153
gi 502586333  72 NPMGMFQYTVWKDVHSHEEMHHDNFKEIFELCSGCLGMVIEGPWEPYFEVVKSDLPQIMSMTDVPQVLGDSFAKQERV-- 149
gi 81343400   88 NPLELWQYTVWEKWEDHEEMHYQQFDRIFELCVGCFTEVVEGPNEPIYVVREANMPPVIDFTDVPKVLGESMMQAMQGkg 167
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CB2_A       148 DIPVISQPYgKRVVAFAEHSVIPGKEKQFEDAIVRTLEMLKK-APGFLGAMVLKEIGVSGIGSMQFGAKGFHQVLENPGS 226
gi 74567748  147 GVPPISQPYgRRTIALSEHTVKKGMEKDFESNIVEVMKDFRN-APGFLGYMILKEVGVSAVGSFQLKSQGIHEALESNGE 225
gi 74574131  148 SIPPISQPYgKRVVAFGEHIVKEGLENQFEEYAIKTLEAFRS-APGFLGGMILKEIGVSPLGSLQLNAKGFHQILETANG 226
gi 505072368 165 --PKVRLAM-RRLVALGEHHVREGHEQAFLEGAVKTLELLQEhAPGMIGWMILEKQGEAALSTFQLEPPAFWESLQTLGA 241
gi 850914694 148 DIPVISQPYgKRVVAFAEHSVIPGKEKQFEDAIVRTLEMLKK-APGFLGAMVLKEIGVSGIGSMQFGAKGFHQVLENPGS 226
gi 339284496 148 --PAVSLPYgQRIVAASDHTVIPGREKDFEQAIVDVMTAFKK-APGFLGYMVMKQIGASAIGAMQLTPQGIHQALQTRGD 224
gi 505070884 162 DIGHLAVDSgETVTVLATHIVRPGKEAEFEEGEIRTMELLRE-SNGMIGYQILKRVGISTLGSGHATVESIMERMK---D 237
gi 256578139 154 ----IRFATpQRCVAIGEHTVAPGKEKAFEKGAIETMEALSD-ATGFLGYMILKQIGVCALGSFMLDPTSMAETLQTLGA 228
gi 502586333 150 --PKVALSS-QRTVVIGDHWVMDGHEKAFEQGATETLEWMKAnVPGMVGWMIMKQFGVSAIGSFQLDPEGAMKAVSTLGA 226
gi 81343400  168 GIPKVRLLT-QRIAVVGIHKVKEGMEEKFIEGAVETLELLNKySAGMIGWMILEKIGESPYGTFQIKPPEFWEVVASRGA 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CB2_A       227 Le-PDPNNVMY--------SVPEAKNTPQQYIVHVEWANTDALMFGMGRVLLYPELRQVHDe-VLDTLVY-GPYIRILNP 295
gi 74567748  226 V--PQHQEGAF--------SYEEARPTPPEYFVHMEWATPQDAQFGIARVLFKHETRVLHDk-VLDTLIK-GPYIRLLNP 293
gi 74574131  227 MdvPEP-VTIY--------EAPEFRNRPQRYIVHTEWSDTNALMFGLGRVLIYPEVRQIHDk-VLDTLVY-GPYIRVLNP 295
gi 505072368 242 Np-PKSRRTNFgefgkdytSPPIPIGGPKEYQVHMEWESPDALTFGLALTGVNPKLRRIHDegVLAHLAKlPPYYRVFAP 320
gi 850914694 227 Le-PDPNNVMY--------SVPEAKNTPQQYIVHVEWANTDALMFGMGRVLLYPELRQVHDe-VLDTLVY-GPYIRILNP 295
gi 339284496 225 Np-PRDKEGNF--------QPMQAHSSPQEYVVHMEWADMNSAMMGISRVVVNHKMRMIHDr-VLETVLK-GPYVTLWNP 293
gi 505070884 238 TpdAKLQRTA---------EVWEGYTIPAEYLVMVEWESLHAAQRGMPHVNVKPDILFVHGpkVFNNCVR-MPTVRMAVS 307
gi 256578139 229 Np-PKKPRPLF--------KTLDAMPRPPEYLIHSEWDATEMAQMGFAKVLVNHAIRKIHDdgVMAHLIR-GPYIMFFQP 298
gi 502586333 227 Np-PEY-NTNYgnk--vhdKPPIPGQTPTQYLVHIEWESPEHAHQGLGHVMVDYELRQIHNngVLAHLDK-GPYYMFFSP 301
gi 81343400  247 Vp-PKTRETIWgeyg-kpeFQLEPAGHPKEFIVHMEWSRPESAMFGPALTAVNPKIKKVHDekVMTTLAHiPPYYKVFMP 324

                 ....*...
2CB2_A       296 MMEGTFWR 303
gi 74567748  294 MMEGTSWR 301
gi 74574131  296 MMEGTYWR 303
gi 505072368 321 AMEDMIFF 328
gi 850914694 296 MMEGTFWR 303
gi 339284496 294 IMEDTSWR 301
gi 505070884 308 MFAEQTYR 315
gi 256578139 299 MMEEPGWR 306
gi 502586333 302 MMEQGLWR 309
gi 81343400  325 LMEDLILF 332
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap