1R8J,1V2Z


Conserved Protein Domain Family
KaiA

?
pfam07688: KaiA 
Click on image for an interactive view with Cn3D
KaiA C-terminal domain
The cyanobacterial clock proteins KaiA and KaiB are proposed as regulators of the circadian rhythm in cyanobacteria. The overall fold of the KaiA C-terminal domain is that of a four-helix bundle, which forms a dimer in the known structure.
Statistics
?
PSSM-Id: 311563
View PSSM: pfam07688
Aligned: 24 rows
Threshold Bit Score: 209.801
Threshold Setting Gi: 49259470
Created: 21-Jul-2016
Updated: 4-Aug-2016
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1R8J_B        167 ERLGYLGVYYKRDPDRFLRNLPAYESQKLHQAMQTSYREIVLSYFSPNSNLNQSIDNFVNMAFFADVPVTKVVEIHMELM 246
gi 123160344  203 ERLGYLGVYYKRNPTNFIRNMAPGERDKFVDQLKLEYRHIVLKYFSQDNSLNNNIDDFVNLCFFSDIPVTQVVEIHMDLM 282
1V2Z_A          1 ------------sTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELM 68
gi 54036113   161 ERLGYLGVYYKRDTAFFFRRMSPADKRKLLDELRSIYRTIVLEYFNTDAKVNERIDEFVSKAFFADISVSQVLEIHVELM 240
gi 1028044876 190 ERLGYLGVYYKRNPKRFLRNLPPAERQHFLDELQAEYRDIVLNYFSTDGSLNQKIDEMVSTAFLADISVTQIVEIHMDLM 269
gi 497454208  168 ERLGYLGVYYKRDPKNFFRHLPPEQKHQLLEKLKTDYRDIVLRYFANDGTLNQRIDDFVNTAFFTDVSAAQIVEIHMELM 247
gi 504992503  184 ERLGYLGVYYKRNSQIFLRNLSGSEKQKFLEQLKSSYRDIVLNYFSQDAAVNNQIDEFVNLAFFADVPVTQIVEIHMELM 263
gi 504986168  176 ERLGYLGVYYKRDSRYFLRHLSLQEKQELLDKLRFTYREIILGYFSQDDQLNQKIDEFVNLAFFSDIPVTQIVEIHMDLM 255
gi 493667910  160 ERLGYLGVYYKRNPKNFLRNLSKADRQKLLEQLKSQYRQIVLSYFANDKNLNNKIDEYVNTAFFGDIPVTRIVEIHMDLM 239
gi 504923535  145 GRLGYLGVYYKRDPSRFLRNLEAEERNELLDSLRRTYRDLLISYFKNPAAANQAIESFVNTAFFADLPITKMVEIHVNLI 224
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
1R8J_B        247 DEFAKKLRVEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRE 288
gi 123160344  283 DEFAIQLRLEGRSEEMLLDYRLTLIDTIAHLCEMYRRSIPRE 324
1V2Z_A         69 DTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRE 110
gi 54036113   241 DTFSKQLKLEGRSEDILLDYRLTLIDVIAHLCEMYRRSIPRE 282
gi 1028044876 270 DDFSKQLKLEGRSEEILLDYRLTLIDIIAHLCEMYRRSIPRD 311
gi 497454208  248 DEFSKQLKLEGRSEEILLDYRLTLIDTIAHLCEMYRRSIPRE 289
gi 504992503  264 DEFAKQLKLEGRNEEILLDYRLTLIDAIAHMCEMYRRSIPKE 305
gi 504986168  256 DEFSKQLKLEGRSEDILLDYRLTLIDTIAHLCEMYRRSIPRE 297
gi 493667910  240 DNFSKQLKLEGRSEDVLLDYRLTLIDTLAHLCEMYRRSIPRE 281
gi 504923535  225 EEFRKLLMLKGQKNDFLQDYRLALLDVMAHLCEMYRRSIPpd 266
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap