Conserved Protein Domain Family
7TM-7TMR_HD

?
pfam07698: 7TM-7TMR_HD 
7TM receptor with intracellular HD hydrolase
These bacterial 7TM receptor proteins have an intracellular pfam01966. This entry corresponds to the 7 helix transmembrane domain. These proteins also contain an N-terminal extracellular domain.
Statistics
?
PSSM-Id: 336771
View PSSM: pfam07698
Aligned: 71 rows
Threshold Bit Score: 49.478
Threshold Setting Gi: 147848446
Created: 27-Mar-2017
Updated: 23-May-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123516584 330 LSVFLGIFLTIILLSLVLYYWRIRNwPKKYARSNVDLLFLSTTAFFQILLVKTgifMSDaINrafpylsmetcFFAIPFA 409
gi 81708754  342 WPELGLLAVIQIVAFSTFLGIDKRLgRACLCKRD-------YLLTLVVALGTAiigVIIgNSwg--------wGGFLPFI 406
gi 81484243  214 fiIALNLIFLLVISSIFNVVTTKFY-SKEILEKN-KYRAIMLLTIATLLVFRI---V----Pss--------mIYLLPLD 276
gi 81313487  264 rlILGGQILFVGILILCFMLYLELF-RKDYYERKGSLSLLFALIVFYCVITAL---MVT-NNif--------nVYILPYA 330
gi 81417096  253 FTRNLGIFLIIFFLLLALWAYMLSF-RPVFFDRLHNSFFVLSLILVINLITEL---AIS-FGwf--------nIYIIPFI 319
gi 492443049 264 rLTLAGQILYVGIFLFCFMAYLELF-RADYYERKGTLTLLFALIVFFPVLSSI---MVE-QNls--------sIYVVPFA 330
gi 524592577 255 giIMGGQFVLAFGILFCFWLYLWSF-RLKILHNRRNALFLVLCVFVSCILTEL---CVT-YGlf--------nVYILPFA 321
gi 502953133 264 YWVIFGYTILVSLALLMLLLFIKKY-RIEIFENNTQITFIFFNVLVMVLLTTL---VVK-YNpe--------fVYLVPLC 330
gi 500028675 264 NWIIVGYSTLVALALLMLLLFMRKY-RMSIFENNVKVTFIFFNIIFMVMLTTL---AVS-FNid--------yVYVVPLC 330
gi 506234789 264 YFILSGYTILVALVLIMLLLFLKRY-RPDVFRNNVKVTFIFFNILVMVFLTTF---VVK-YNea--------lVFVVPLC 330
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 123516584 410 AGAMLVAVLTNRNMALILNIFISFLISFLfEYDIKMSLFCFLGSIAASYHVVRCRQRSAFLKAGLYLGFFNIAVIACISL 489
gi 81708754  407 AAGLLLGNFYGSLRGSVALLALAVPFWYGlaLPPAIFWPVLAGGLVAAVQVGRLRSREEMAFLGVLAAAVQGGVYALLNL 486
gi 81484243  277 TMLLLLLFIVKPRFSVFLTMIVISYMLPItDYDLKYFTIQSIAIFATGFLSKNISTRSSVIAIGIQLAILKILLYLILSF 356
gi 81313487  331 MLPIIIRVFLDSRTAFLTHVITILICSITlRYPHEFILTQIAAGLVAIFSLRELSQRSQLFRTALLVILTYAAIYFAFEL 410
gi 81417096  320 ILPILVRTFHDSRTAFFAHVINVLIVAMFvPDIYEFILLQVLAGIVSVTSMRRLTSRLQLVRTTFLVFLTYSVVQLSFSL 399
gi 492443049 331 MIPIIVRVFLDSRTAFMAHVTIILLCSITlRFPHEFILLQVVAGMVAIYSLRELSQRSQLLRTALVVFISYALLYFAFEL 410
gi 524592577 322 IVPIVVRTFFDSRTALFTHLIIVLICSLMvPFPHEFLLLQVIAGMVVTFSLRDLYERSQLIRCAFFIFMSYALCYISLSI 401
gi 502953133 331 ILPLTLKAFFDARLGLFTHVITVLLLGFIvPNSYEYMFLQILAGIVTILTVSELYKRANLFISVAQITLVYILAYFAFTI 410
gi 500028675 331 ILPLTLKAFFDARLGLFTHVITVLLLGFIvPNSYEYMFLQIIAGIVTILTVSELYKRANLFISVGQITLVYIIAYFAFTV 410
gi 506234789 331 ILPLILKTFFDARLGLFVHVLTVLILGFVvPNSFEYIFLQIIAGIVTILTVSELYKRANLFISVGQITLIYILGYFAFNI 410
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....
gi 123516584 490 IMNEIFSf-DLFSKLAMGMAGGLLSGVIVAGMTPLFETIFKYTT 532
gi 81708754  487 VFPAGYDwrELLIHTGEMFGGGLVCSIVALGASPYLERLFDVVT 530
gi 81484243  357 FSVEE-Sy-GVALNTIKIFISGLFSGMFAIALLPYFERTFNILT 398
gi 81313487  411 ISENDLS--KLNVSMYIYFIINGVLLLFAYPLLFLLEKTFGFTS 452
gi 81417096  400 MQDGRVE--MGDGLNILYFGVNLIFLMFSYLLVYLMERAFGYVS 441
gi 492443049 411 IHEDDLT--KLNTRMYIYFMINGILLLFAYPLLFLLEKIFGFTS 452
gi 524592577 402 YQEADFK--KINWMMMLYFGINFILLMFTYILVYMLEKTFGYVS 443
gi 502953133 411 TREGTVT--AMNWETILYFVTCGLATLFVQPLIYAFEKVFGMVS 452
gi 500028675 411 IQEGNID--DMKPEVFLTFLLGGLATLFVQPLIYVYEKIFGMVS 452
gi 506234789 411 IQGGSLD--NVVWVNFGFFLLNGMITLFVQPLIYIYEKMFGMVS 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap